fadB4 Family assigned · medium auto-curated
H37Rv Rv3141 · MTBC0 mtbc0_003339 ·
323 aa ·
3530797–3531768 MTBC0
(+) ·
RefSeq NP_217657.1
Genomic neighbourhood (genome browser)
Open in full genome browser →This gene (outlined) in its genomic context; arrows are neighbouring genes coloured by verdict. Click any gene to navigate. Pan and zoom in the full browser.
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | NADPH quinone oxidoreductase FadB |
|---|---|
| MTBC0 PGAP re-annotation | NADPH:quinone oxidoreductase family protein |
| Revised (this work) | NADPH:quinone oxidoreductase family protein. Pfam: ADH_N (PF08240.18), ADH_zinc_N (PF00107.33), ADH_zinc_N_2 (PF13602.13). |
| Functional category (TubercuList) | lipid metabolism |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
In the literature (TB corpus sweep) 2 publications
2 TB publications mention this gene. 2 publication(s) discuss this gene (2 in a M. tuberculosis context).
| Publication | Date |
|---|---|
| A Persistent Tuberculosis Outbreak in the UK Is Characterized by Hydrophobic fadB4-Deficient Mycobacterium tuberculosis That Replicates Rapidly in Macrophages. doi:10.1128/mbio.02656-22 | 2022 |
| Inactivation of the Mycobacterium tuberculosis fadB4 gene results in increased virulence in host cell and mice. doi:10.1016/j.micinf.2007.10.001 | 2008 |
This layer CITES the literature and adds context; it does not change the verdict or the function stated elsewhere in this fiche. This distinguishes a gene that is dark because nobody has looked from one that is dark despite having been studied. Source: PubMed (whole): H37Rv locus tag + GENE NAME + ortholog identifiers (Mb…, MMAR_…, MSMEG_…, ML…, MAB_…), under a mycobacterial context filter; hits verified against the abstract text. Species-context counts distinguish M. tuberculosis literature from literature on other mycobacteria. phase76/phase77, 2026-07-13.
CRISPRi vulnerability
Vulnerability index 1.22 (95% CI -0.04 to 3.44). A more negative index = more vulnerable to knockdown (better drug-target quality); indicative threshold VI ≤ -6 = highly vulnerable.
Quantitative CRISPRi knockdown, graded (finer than binary Tn-seq essentiality). Source: CRISPRi vulnerability index (Bosch 2021, pebble.rockefeller.edu).
Legacy record & comparison (Mycobrowser)
| Mycobrowser function | Involved in lipid degradation [catalytic activity: NADPH + quinone = NADP(+) + semiquinone]. |
|---|---|
| Mycobrowser EC |
1.6.5.5
· agrees with the atlas
|
The legacy Mycobrowser record is shown for verification. Mycobrowser is no longer maintained; its EC numbers predate recent nomenclature revisions, so a class change usually reflects re-numbering, not a conflict.
Orthologues (reciprocal best hits across mycobacteria)
| M. bovis |
Mb3165
· 100.0% identity |
|---|---|
| M. marinum |
MMAR_1498
· 83.5% identity |
| M. smegmatis |
MSMEG_2033
· 73.1% identity |
| M. orygis |
RJtmp_003236
· 100.0% identity |
Reciprocal-best-hit orthologues (DIAMOND) against the Mycobrowser reference proteomes. A missing species is informative: e.g. a gene absent from M. leprae was likely lost in its reductive genome evolution. Locus tags link to Mycobrowser.
Curated reference (UniProt)
| UniProt |
P95185
TrEMBL · unreviewed
· Evidence at protein level
|
|---|---|
| UniProt name | Probable NADPH quinone oxidoreductase FadB4 |
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
C Energy production and conversion
|
|---|---|
| Preferred name | fadB4 |
| eggNOG description | NADPH quinone |
| Orthologous group | COG0604 |
| EC number |
EC 1.6.5.5
|
| KEGG orthology |
K00344
|
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS | 0.192 · strong purifying |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 2 synonymous, 1 missense, 0 nonsense, 0 frameshift |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Outgroup conservation (beyond the MTBC) Bacteria
| M. canettii dN/dS (deep-divergence selection) |
0.0 (low power)
· 1 consensus substitution(s) low power (1 canettii-consensus substitution(s)); present in M. canettii but dN/dS not reliable |
|---|---|
| Genus-wide presence (~53 non-MTBC Mycobacterium) |
present in 52/53 (98%) · mean identity 80.5%
· 4/4 closest MTBAP relatives conserved across the genus (present in 52/53 non-MTBC Mycobacterium genomes, incl. distant relatives) — an ancient core gene predating the genus radiation |
| Phylostratum (deepest detected homolog) |
MTBC-specific → Mycobacterium → Mycobacteriaceae → Corynebacteriales → Actinomycetia → Bacteria detected in 7/13 non-Mycobacterium reference genomes (down to Bacteria) · mean identity 48.0% detected down to outside the phylum (Proteobacteria/Firmicutes controls) — a universally conserved, ancient bacterial gene |
Two orthogonal outgroup signals. M. canettii (the immediate outgroup) gives a deep-divergence dN/dS (a low value confirms a constrained, real gene; shown as confident only at ≥8 substitutions, else flagged low-power). Genus-wide presence/absence (tblastn vs assembled non-MTBC genomes) places the gene on the ancient-core ↔ MTBC-specific axis: a gene absent even from the closest MTBAP relatives is a candidate MTBC-specific innovation (possible host-adaptation factor, to confirm by synteny). The phylostratum extends that axis outside the genus (tblastn vs 13 reference genomes spanning Mycobacteriaceae → Corynebacteriales → Actinomycetia → outside the phylum): it is the deepest clade in which a homolog is still detected, i.e. a proxy for gene age. Read it with the null model in mind: a shallow (young) stratum can also reflect homology-detection failure for short or fast-evolving ORFs, so it is a descriptive axis, not a proof of novelty.
Essentiality (transposon mutagenesis)
| DeJesus 2017 call | NE · non-essential |
|---|---|
| What the call means | non-essential |
| TA sites (Himar1) | 17 in the ORF — 0 in the essential state, 0 growth-defect, 17 non-essential, 0 growth-advantage. Saturation 1.000, mean read count 80.9411764706. A region of the protein devoid of TA sites is invisible to this assay: nothing can be inferred about it, in either direction. |
Genome-wide Himar1 transposon essentiality in H37Rv (DeJesus 2017). An essential call (ES/ESD/GD) is strong, independent evidence that a "hypothetical" locus encodes a functional, selectively required gene — orthogonal to intra-species conservation.
Proteomics (mass spectrometry) detected
| MS detection | detected in 15 of 16 independent MS datasets |
|---|---|
| Integrated abundance | 202.0 ppm · rank 842/3519 (76.1th percentile) |
Detection by mass spectrometry is direct, experimental evidence that the protein product exists — orthogonal to sequence conservation and to Tn-seq essentiality, and especially decisive for a "hypothetical" locus. Reproducible detection across several independent datasets (PaxDb) makes the existence claim robust; the integrated abundance places the protein in the proteome's dynamic range.
Physico-chemical properties (computed, ProtParam)
| Length | 323 aa |
|---|---|
| Molecular weight | 33.9 kDa |
| Theoretical pI | 5.43 |
| GRAVY | 0.18 (hydrophobic) |
| Aliphatic index | 105.0 |
| Aromaticity | 0.05 |
| Instability index | 29.0 (stable) |
Computed from the ancestral MTBC0 sequence with the ExPASy ProtParam method (Biopython). Descriptive biophysical context: a positive GRAVY flags a hydrophobic (often membrane) protein, a high instability index (>40) predicts a short in-vitro half-life, an extreme pI hints at compartment or binding partner.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
ADH_N | PF08240.18 | 1.1e-11 | 27–108 | Alcohol dehydrogenase GroES-like domain |
ADH_zinc_N | PF00107.33 | 2.9e-26 | 149–265 | Zinc-binding dehydrogenase |
ADH_zinc_N_2 | PF13602.13 | 3.0e-19 | 183–319 | Zinc-binding dehydrogenase |
Structural search (AlphaFold DB model, Foldseek vs PDB — genome-wide) pLDDT 96.0
| PDB hit | prob | TM-score | E-value | Description |
|---|---|---|---|---|
4eye-assembly1_A |
1.00 | 0.93 | 1.3e-37 sig | 4eye-assembly1_A Crystal structure of a probable oxidoreductase from Mycobacterium abscessus solved by iodide ion SAD |
4eye-assembly2_B |
1.00 | 0.94 | 4.3e-36 sig | 4eye-assembly2_B Crystal structure of a probable oxidoreductase from Mycobacterium abscessus solved by iodide ion SAD |
1yb5-assembly1_A |
1.00 | 0.90 | 3.6e-31 sig | 1yb5-assembly1_A Crystal structure of human Zeta-Crystallin with bound NADP |
6lii-assembly2_C |
1.00 | 0.89 | 1.9e-30 sig | 6lii-assembly2_C A quinone oxidoreductase |
6k9y-assembly2_D |
1.00 | 0.89 | 1.3e-30 sig | 6k9y-assembly2_D Crystal structure of human VAT-1 |
Foldseek search of the AlphaFold DB model (mean pLDDT 96.0, gated at 70) against the PDB — a genome-wide extension of the ESMFold dark-gene search that also covers proteins beyond the single-sequence length limit. Confident structural neighbours (E < 0.01) shown.
Genomic context (neighbours & predicted operon)
| Upstream (5' on genome) | fadE23 (+ strand, 99 bp gap) |
|---|---|
| Downstream (3' on genome) | Rv3142c (- strand, 51 bp gap) |
Neighbours from the H37Rv annotation (+ strand). The operon is predicted by co-directional intergenic distance (same strand, gaps ≤50 bp) — a transcription-unit hypothesis, not a mapped TSS. For a "hypothetical", co-transcription with a characterised operon is a concrete functional lead (complements the STRING neighborhood channel below).
Functional interaction network (STRING v12, guilt-by-association)
Explore full network →Node colour = verdict, dashed = hypothetical; edge colour = evidence (green experimental, orange genomic-context, grey co-expression), width ∝ score. Click a partner to open its page; "Explore full network" to walk the graph.
Closest characterised functional partner: pks15 (polyketide synthase), high confidence from genomic context alone (score 915 excluding text-mining).
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv2947c pks15 |
polyketide synthase | 916 | 915 ctx | fusion:899 |
Rv2382c mbtC |
polyketide synthetase | 915 | 915 ctx | fusion:899 |
Rv1180 pks3 |
polyketide beta-ketoacyl synthase | 915 | 914 ctx | fusion:898 |
Rv0130 htdZ |
3-hydroxyl-thioester dehydratase | 815 | 811 ctx | fusion:741 |
Rv1664 pks9 |
polyketide synthase | 752 | 751 ctx | fusion:702 |
Rv3140 fadE23 |
acyl-CoA dehydrogenase FadE23 | 814 | 664 ctx | neighborhood:615 textmining:469 |
Rv3139 fadE24 |
acyl-CoA dehydrogenase | 793 | 606 ctx | neighborhood:548 textmining:498 |
Rv3761c fadE36 |
acyl-CoA dehydrogenase FadE36 | 478 | 479 | |
Rv0154c fadE2 |
acyl-CoA dehydrogenase FadE2 | 459 | 460 | |
Rv0405 pks6 |
membrane bound polyketide synthase | 449 | 422 | |
Rv2932 ppsB |
phthiocerol synthesis polyketide synthase type I PpsB | 433 | 396 | |
Rv3138 pflA |
pyruvate formate lyase activating protein PflA | 873 | 385 | textmining:803 |
Rv3137 hisN |
histidinol-phosphatase | 780 | 368 | textmining:666 |
Rv2524c fas |
fatty acid synthase | 404 | 304 | |
Rv1912c fadB5 |
oxidoreductase FadB | 497 | 298 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The exp badge marks an experimentally-supported partner (measured interaction, experimental/database channel ≥400) as opposed to a purely predicted one — but note that the M. tuberculosis experimental interactome is dominated by a noisy bacterial-two-hybrid screen, so a strong measured link that contradicts the operon/localisation context is likely a false positive. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Legacy H37Rv annotation: NADPH quinone oxidoreductase FadB
- MTBC0 PGAP product: NADPH:quinone oxidoreductase family protein
- Pfam (hmmscan --cut_ga): ADH_N PF08240.18 (E=1e-11), ADH_zinc_N PF00107.33 (E=3e-26), ADH_zinc_N_2 PF13602.13 (E=3e-19)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_217657.1)
- Domains: Pfam-A via hmmscan --cut_ga — ADH_N (PF08240.18), ADH_zinc_N (PF00107.33), ADH_zinc_N_2 (PF13602.13)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
COG0604 - Curated reference: UniProt P95185 (TrEMBL, unreviewed; Evidence at protein level)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Genome-wide structure: AlphaFold DB model (Jumper et al. 2021, doi:10.1038/s41586-021-03819-2; Varadi et al. 2024, doi:10.1093/nar/gkad1011) searched vs PDB with Foldseek (mean pLDDT 96.0)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
21 functional partner(s); context anchor
pks15 - Essentiality: genome-wide transposon mutagenesis in H37Rv — DeJesus et al. 2017 (mBio, doi:10.1128/mBio.02133-16, CC BY)
- Proteomics: integrated mass-spectrometry abundance from PaxDb 5.0 (Huang et al. 2023, doi:10.1016/j.mcpro.2023.100640), taxon 83332 — weighted average of 16 datasets, incl. Schubert et al. 2013 (doi:10.1016/j.chom.2013.04.008) and Albrethsen et al. 2013 (doi:10.1074/mcp.M112.018846)
- Functional category: TubercuList scheme (Cole et al. 1998, doi:10.1038/31159), via Mycobrowser (Kapopoulou et al. 2011, doi:10.1016/j.tube.2010.09.006)
- Orthologues: reciprocal best hits (DIAMOND, Buchfink et al. 2021, doi:10.1038/s41592-021-01101-x) against Mycobrowser release 5 reference proteomes
- Genomic context / operon: H37Rv annotation; operon predicted by co-directional intergenic distance (Salgado et al. 2000, doi:10.1073/pnas.030539397)
- Physico-chemical properties: ExPASy ProtParam method via Biopython (Gasteiger et al. 2005), computed from the MTBC0 sequence
- Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>mtbc0_003339|Rv3141|fadB4 MRAVRVTRLEGPDAVEVAEVEEPTSAGVVIEVHAAGVAFPDALLTRGRYQYRPEPPFVLGAEIAGVVRSAPDNSQVRSGDRVVGLTMLTGGMAEVAVLSPERVFKLPDNMTFEAGAGVLFNDLTVYFALAVRGRLQAGETVLVHGAAGGIGTSTLRLAPALGASRTVAVVSTQEKAELATVAGATDVVLAEGFKDAVQELTNGRGVDIVVDPVGGDRFTDSLRSLAAGGRLLVIGFTGGEIPTVKVNRLLLNNIDVVGVGWGAWSLTHPDALAQQWSQLERLLRSGKLPPPEPVVYPLDQAAAAIASLENRTAKGKVVLRVRD
Spot an error? Suggest an improvement
Found a mistake, a missing reference, or have a better functional hypothesis for fadB4? Email the maintainer — the message is pre-filled with this gene's details.