fadB4 Family assigned · medium auto-curated

H37Rv Rv3141 · MTBC0 mtbc0_003339 · 323 aa · 3530797–3531768 (+) · RefSeq NP_217657.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)NADPH quinone oxidoreductase FadB
MTBC0 PGAP re-annotationNADPH:quinone oxidoreductase family protein
Revised (this work)NADPH:quinone oxidoreductase family protein. Pfam: ADH_N (PF08240.18), ADH_zinc_N (PF00107.33), ADH_zinc_N_2 (PF13602.13).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt P95185 TrEMBL · unreviewed · Evidence at protein level
UniProt nameProbable NADPH quinone oxidoreductase FadB4

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category C Energy production and conversion
Preferred namefadB4
eggNOG descriptionNADPH quinone
Orthologous groupCOG0604
EC number EC 1.6.5.5
KEGG orthology K00344

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.192 · strong purifying
Polymorphic sites (≥ 0.1% of strains) 2 synonymous, 1 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
ADH_NPF08240.18 1.1e-1127–108 Alcohol dehydrogenase GroES-like domain
ADH_zinc_NPF00107.33 2.9e-26149–265 Zinc-binding dehydrogenase
ADH_zinc_N_2PF13602.13 3.0e-19183–319 Zinc-binding dehydrogenase

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: pks15 (polyketide synthase), high confidence from genomic context alone (score 915 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv2947c pks15 polyketide synthase 916 915 ctx fusion:899
Rv2382c mbtC polyketide synthetase 915 915 ctx fusion:899
Rv1180 pks3 polyketide beta-ketoacyl synthase 915 914 ctx fusion:898
Rv0130 htdZ 3-hydroxyl-thioester dehydratase 815 811 ctx fusion:741
Rv1664 pks9 polyketide synthase 752 751 ctx fusion:702
Rv3140 fadE23 acyl-CoA dehydrogenase FadE23 814 664 ctx neighborhood:615 textmining:469
Rv3139 fadE24 acyl-CoA dehydrogenase 793 606 ctx neighborhood:548 textmining:498
Rv3761c fadE36 acyl-CoA dehydrogenase FadE36 478 479
Rv0154c fadE2 acyl-CoA dehydrogenase FadE2 459 460
Rv0405 pks6 membrane bound polyketide synthase 449 422
Rv2932 ppsB phthiocerol synthesis polyketide synthase type I PpsB 433 396
Rv3138 pflA pyruvate formate lyase activating protein PflA 873 385 textmining:803
Rv3137 hisN histidinol-phosphatase 780 368 textmining:666
Rv2524c fas fatty acid synthase 404 304
Rv1912c fadB5 oxidoreductase FadB 497 298

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: NADPH quinone oxidoreductase FadB
  • MTBC0 PGAP product: NADPH:quinone oxidoreductase family protein
  • Pfam (hmmscan --cut_ga): ADH_N PF08240.18 (E=1e-11), ADH_zinc_N PF00107.33 (E=3e-26), ADH_zinc_N_2 PF13602.13 (E=3e-19)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_217657.1)
  • Domains: Pfam-A via hmmscan --cut_ga — ADH_N (PF08240.18), ADH_zinc_N (PF00107.33), ADH_zinc_N_2 (PF13602.13)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG0604
  • Curated reference: UniProt P95185 (TrEMBL, unreviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 21 functional partner(s); context anchor pks15
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_003339|Rv3141|fadB4
MRAVRVTRLEGPDAVEVAEVEEPTSAGVVIEVHAAGVAFPDALLTRGRYQYRPEPPFVLGAEIAGVVRSAPDNSQVRSGDRVVGLTMLTGGMAEVAVLSPERVFKLPDNMTFEAGAGVLFNDLTVYFALAVRGRLQAGETVLVHGAAGGIGTSTLRLAPALGASRTVAVVSTQEKAELATVAGATDVVLAEGFKDAVQELTNGRGVDIVVDPVGGDRFTDSLRSLAAGGRLLVIGFTGGEIPTVKVNRLLLNNIDVVGVGWGAWSLTHPDALAQQWSQLERLLRSGKLPPPEPVVYPLDQAAAAIASLENRTAKGKVVLRVRD