Rv2812 Family assigned · low auto-curated

H37Rv Rv2812 · MTBC0 mtbc0_002992 · 310 aa · 3139241–3140652 (+) · RefSeq NP_217328.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)transposase
MTBC0 PGAP re-annotationDDE-type integrase/transposase/recombinase
Revised (this work)Helix-turn-helix domain-containing protein.

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt P71639 TrEMBL · unreviewed · Predicted
UniProt nameProbable transposase

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category L Replication, recombination and repair
eggNOG descriptionPFAM Integrase, catalytic
Orthologous groupCOG2801
KEGG orthology K07497

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains) pseudogene candidate

pN/pS 1.591 · diversifying/relaxed
Polymorphic sites (≥ 0.1% of strains) 2 synonymous, 8 missense, 1 nonsense, 2 frameshift
Disruption 3 distinct premature-stop/frameshift site(s); most common in 4.28% of strains (6221) · clonal

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

No Pfam-A domain above the gathering threshold (or not yet scanned).

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: Rv3349c (transposase), medium confidence from genomic context alone (score 587 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv2813 hyp hypothetical protein 977 977 ctx neighborhood:882 cooccurence:643
Rv3786c hyp hypothetical protein 738 739 ctx cooccurence:738
Rv2811 hyp hypothetical protein 635 635 ctx neighborhood:620
Rv1978 hyp hypothetical protein 630 630 ctx cooccurence:630
Rv3899c hyp hypothetical protein 612 611 ctx cooccurence:605
Rv3349c transposase 587 587 ctx cooccurence:581
Rv3604c transmembrane protein 578 578 ctx cooccurence:577
Rv3887c eccD2 ESX-2 secretion system protein EccD 567 568 ctx cooccurence:565
Rv3912 rsmA anti-sigma-M factor RsmA 554 554 ctx cooccurence:552
Rv3896c hyp hypothetical protein 552 552 ctx cooccurence:551
Rv0804 hyp hypothetical protein 531 532 ctx cooccurence:529
Rv1158c hyp hypothetical protein 483 484 ctx cooccurence:482
Rv2633c hyp hypothetical protein 477 477 ctx cooccurence:477
Rv1435c hyp hypothetical protein 465 465 ctx cooccurence:465
Rv2810c Probable transposase; Rv2810c, (MTCY16B7.33), len: 133 aa. Probable transposase for IS1555, similar to C-terminal domain of transposases for 446 446 ctx neighborhood:438

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: transposase
  • MTBC0 PGAP product: helix-turn-helix domain-containing protein
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_217328.1)
  • Domains: Pfam-A via hmmscan --cut_ga — none above threshold
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG2801
  • Curated reference: UniProt P71639 (TrEMBL, unreviewed; Predicted)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 19 functional partner(s); context anchor Rv3349c
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_002992|Rv2812|
MAVGDDEEKVRAERARAIGLFRYQLIWEAADAAHSTKQRGKMVRELASREHTDPFGRRVRISRQTIDRWIRGWRAGGFDALVPNPRQCTPRTPAEVLELAVALRRENPQRTAAAIRRILRTQLGWAPDERTLQRNFHRLGLTGATTGSAPAVFGRFEAEHPNALWTGDVLHGIRIDLRKTYLFAFLDDHSRLVPGYRWGHAEDTVRLAAALRPALASRGVPNAVYVDNGSPYVDAWLLRACAKLGVRLVHSTPGRPQGRGKIERFFRTVREQFLVEITGEPDVVGRHYVADLAELNRLFTAWVETVYHRS