Rv3771c Still unknown · low auto-curated

H37Rv Rv3771c · MTBC0 mtbc0_003996 · 108 aa · 4240525–4240851 (-) · RefSeq NP_218288.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)hypothetical protein
MTBC0 PGAP re-annotationhypothetical protein
Revised (this work)Conserved hypothetical protein; no recognised domain. Function unknown. Foldseek best (non-significant) hit: 4l6y-assembly1_A Structure of the microtubule associated protein PRC1 (prob 0.20, TM 0.52).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt P72038 TrEMBL · unreviewed · Predicted
UniProt nameUncharacterized protein

UniProt still lists this protein as Uncharacterized protein; the revised annotation above is ahead of the current UniProt record.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category L Replication, recombination and repair
eggNOG descriptiontransposition, DNA-mediated
Orthologous groupCOG3677

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS n/a
Polymorphic sites (≥ 0.1% of strains) 0 synonymous, 3 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

No Pfam-A domain above the gathering threshold (or not yet scanned).

Structural neighbours (Foldseek on the ESMFold model, exploratory)

ESMFold model confidence: mean pLDDT 57.0 (low). Low-confidence model: the fold may be unreliable, so treat these structural hits with caution.

Best matches against the PDB, ranked by Foldseek homology probability. A high probability / TM-score suggests a shared fold; unless flagged sig (E < 0.01) these are fold hypotheses, not assignments.

TargetProbTME-valueDescription
4l6y-assembly1_A 0.20 0.52 4.5e+00 4l6y-assembly1_A Structure of the microtubule associated protein PRC1 (Protein Regulator of Cytokinesis 1)
3dzu-assembly1_D 0.06 0.40 8.3e+00 3dzu-assembly1_D Intact PPAR gamma - RXR alpha Nuclear Receptor Complex on DNA bound with BVT.13, 9-cis Retinoic Acid and NCOA2 Peptide
4jeu-assembly1_B 0.01 0.19 8.3e+00 4jeu-assembly1_B Crystal Structure of Munc18a and Syntaxin1 with native N-terminus complex
8rbz-assembly1_d 0.01 0.18 7.8e+00 8rbz-assembly1_d Structure of Integrator-PP2A-SOSS-CTD post-termination complex

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: Rv3770B (Rv3770B, len: 63 aa. Probable remnant of a transposase, similar to many e.g. Rv2812|MTCY16B7.31c|Z81331_17 IS1604 putative transposase from ), medium confidence from genomic context alone (score 546 excluding text-mining). This association is the citable seed of a function hypothesis for this hypothetical protein.

PartnerProductScoreNo text-miningChannels (≥400)
Rv3770B Rv3770B, len: 63 aa. Probable remnant of a transposase, similar to many e.g. Rv2812|MTCY16B7.31c|Z81331_17 IS1604 putative transposase from 545 546 ctx neighborhood:524
Rv3770A Rv3770A, len: 60 aa. Probable remnant of a transposase, similar to many e.g. Rv2812|MTCY16B7.31c|Z81331_17 IS1604 putative transposase from 513 514 ctx neighborhood:494

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: hypothetical protein
  • MTBC0 PGAP product: hypothetical protein
  • Foldseek best: 4l6y-assembly1_A Structure of the microtubule associated protein PRC1 (Protein R (prob 0.20, E=4e+00, TM=0.52)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_218288.1)
  • Domains: Pfam-A via hmmscan --cut_ga — none above threshold
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG3677
  • Curated reference: UniProt P72038 (TrEMBL, unreviewed; Predicted)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Model confidence: ESMFold per-residue pLDDT (mean 57.0, low)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 2 functional partner(s); context anchor Rv3770B
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_003996|Rv3771c|
MPAPAEKALSQVGFRRIAADLARPAETVRGWLRRFAERAEAVRSVFTVMLRAVDPDPVMPDAAVGVFAYAVTVIAAVVTVIECQFALSTVSLAETAVAVSGGRLVAPG