lpqH Resolved · high auto-curated

H37Rv Rv3763 · MTBC0 mtbc0_003987 · 159 aa · 4233168–4233647 (+) · RefSeq NP_218280.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)lipoprotein LpqH
MTBC0 PGAP re-annotationlipoprotein LpqH
Revised (this work)Lipoprotein LpqH. Pfam: Myco_19_kDa (PF05481.18).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt P9WK61 SwissProt · reviewed · Evidence at protein level
UniProt nameLipoprotein LpqH
Curated functionBased on its structure might be involved in ligand transport (By similarity) (Ref.25)..; FUNCTION: A host TLR2 agonist. Plays a complicated role in bacterial interactions with the host immune system; some effects favor the host (induces interleukin 1-beta and IL-12 p40 (IL12B), both increase the host's immune response) while others favor the bacteria (increases growth in monocyte-derived macrophages and decreases host MHC class II (MHC-II) expression and antigen processing). Induces host (human and mouse) IL-12 p40 (IL12B, a pro-inflammatory cytokine) release by monocyte cell lines via TLR2 an.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category S Function unknown
Preferred namelpqH
eggNOG description19 kDa lipoprotein antigen
Orthologous group28UBJ
KEGG orthology K14953
KEGG pathways map05152
Gene Ontology (92) GO:0001906, GO:0001907, GO:0003674, GO:0005488, GO:0005575, GO:0005576, GO:0005618, GO:0005623, GO:0005886, GO:0008150, GO:0009605, GO:0009607 +80 more

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.74 · relaxed/neutral
Polymorphic sites (≥ 0.1% of strains) 1 synonymous, 2 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
Myco_19_kDaPF05481.18 4.7e-3648–158 Mycobacterium 19 kDa lipoprotein antigen

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: Rv3762c (hydrolase), medium confidence from genomic context alone (score 532 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv3762c hydrolase 532 532 ctx neighborhood:512
Rv2220 glnA1 glutamine synthetase 482 246
Rv3846 sodA superoxide dismutase 472 99 textmining:438
Rv1886c fbpB diacylglycerol acyltransferase/mycolyltransferase Ag85B 544 93 textmining:518
Rv1270c lprA lipoprotein LprA 955 87 textmining:954
Rv0934 pstS1 phosphate ABC transporter substrate-binding lipoprotein PstS 867 87 textmining:861
Rv1310 atpD ATP synthase subunit beta 429 71 textmining:411
Rv1368 lprF lipoprotein LprF 753 70 textmining:745
Rv0475 hbhA heparin binding hemagglutinin HbhA 549 67 textmining:537
Rv1860 apa hyp hypothetical protein 681 64 textmining:674
Rv3006 lppZ lipoprotein LppZ 582 64 textmining:573
Rv0583c lpqN lipoprotein LpqN 687 55 textmining:683
Rv0431 tuberculin-like peptide 518 55 textmining:511
Rv1488 hyp hypothetical protein 517 55 textmining:510
Rv3491 hyp hypothetical protein 439 55 textmining:431

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: lipoprotein LpqH
  • MTBC0 PGAP product: lipoprotein LpqH
  • Pfam (hmmscan --cut_ga): Myco_19_kDa PF05481.18 (E=5e-36)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_218280.1)
  • Domains: Pfam-A via hmmscan --cut_ga — Myco_19_kDa (PF05481.18)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG 28UBJ
  • Curated reference: UniProt P9WK61 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 30 functional partner(s); context anchor Rv3762c
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_003987|Rv3763|lpqH
MKRGLTVAVAGAAILVAGLSGCSSNKSTTGSGETTTAAGTTASPGAASGPKVVIDGKDQNVTGSVVCTTAAGNVNIAIGGAATGIAAVLTDGNPPEVKSVGLGNVNGVTLGYTSGTGQGNASATKDGSHYKITGTATGVDMANPMSPVNKSFEIEVTCS