echA3 Family assigned · medium auto-curated

H37Rv Rv0632c · MTBC0 mtbc0_000665 · 231 aa · 732136–732831 MTBC0 (-) · RefSeq NP_215146.1

Genomic neighbourhood (genome browser)

Open in full genome browser →
+ strand − strand vapC30 (Rv0624) — requalified: type II toxin-antitoxin system toxin ribonuclease C30 Rv0625c (Rv0625c) — family_assigned: TVP38/TMEM64 family protein vapB5 (Rv0626) — family_assigned: type II toxin-antitoxin system Phd/YefM family antitoxin vapC5 (Rv0627) — family_assigned: type II toxin-antitoxin system VapC family toxin Rv0628c (Rv0628c) — family_assigned: FIST N-terminal domain-containing protein Rv0628c recD (Rv0629c) — family_assigned: exodeoxyribonuclease V subunit alpha recD recB (Rv0630c) — family_assigned: exodeoxyribonuclease V subunit beta recB recC (Rv0631c) — family_assigned: exodeoxyribonuclease V subunit gamma recC echA3 (Rv0632c) — family_assigned: crotonase/enoyl-CoA hydratase family protein Rv0633c (Rv0633c) — family_assigned: hypothetical protein Rv0633c Rv0634c (Rv0634c) — requalified: MBL fold metallo-hydrolase hadA (Rv0635) — family_assigned: (3R)-hydroxyacyl-ACP dehydratase subunit HadA hadB (Rv0636) — family_assigned: (3R)-hydroxyacyl-ACP dehydratase subunit HadB hadC (Rv0637) — family_assigned: (3R)-hydroxyacyl-ACP dehydratase subunit HadC nusG (Rv0639) — requalified: transcription termination/antitermination protein NusG rplK (Rv0640) — requalified: 50S ribosomal protein L11 rplA (Rv0641) — requalified: 50S ribosomal protein L1 mmaA4 (Rv0642c) — requalified: hydroxymycolate synthase MmaA4 mmaA4 mmaA3 (Rv0643c) — requalified: methoxy mycolic acid synthase MmaA3 mmaA3 mmaA2 (Rv0644c) — requalified: cyclopropane mycolic acid synthase MmaA2 mmaA2 mmaA1 (Rv0645c) — requalified: mycolic acid methyltransferase MmaA1 mmaA1 lipG (Rv0646c) — requalified: lipase/esterase LipG 724 kb 728 kb 732 kb 736 kb 740 kb 744 kb

This gene (outlined) in its genomic context; arrows are neighbouring genes coloured by verdict. Click any gene to navigate. Pan and zoom in the full browser.

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)enoyl-CoA hydratase EchA3
MTBC0 PGAP re-annotationcrotonase/enoyl-CoA hydratase family protein
Revised (this work)Crotonase/enoyl-CoA hydratase family protein. Pfam: ECH_1 (PF00378.26), ECH_2 (PF16113.11).
Functional category (TubercuList)lipid metabolism

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

In the literature (TB corpus sweep) 1 publication

1 TB publication mentions this gene. 1 publication(s) discuss this gene (1 in a M. tuberculosis context).

PublicationDate
Secretome profile analysis of hypervirulent Mycobacterium tuberculosis CPT31 reveals increased production of EsxB and proteins involved in adaptation to intracellular lifestyle. doi:10.1093/femspd/ftv127 2016

This layer CITES the literature and adds context; it does not change the verdict or the function stated elsewhere in this fiche. This distinguishes a gene that is dark because nobody has looked from one that is dark despite having been studied. Source: PubMed (whole): H37Rv locus tag + GENE NAME + ortholog identifiers (Mb…, MMAR_…, MSMEG_…, ML…, MAB_…), under a mycobacterial context filter; hits verified against the abstract text. Species-context counts distinguish M. tuberculosis literature from literature on other mycobacteria. phase76/phase77, 2026-07-13.

CRISPRi vulnerability

Vulnerability index 1.16 (95% CI -0.33 to 3.55). A more negative index = more vulnerable to knockdown (better drug-target quality); indicative threshold VI ≤ -6 = highly vulnerable.

Quantitative CRISPRi knockdown, graded (finer than binary Tn-seq essentiality). Source: CRISPRi vulnerability index (Bosch 2021, pebble.rockefeller.edu).

Legacy record & comparison (Mycobrowser)

Mycobrowser functionCould possibly oxidize fatty acids using specific components [catalytic activity: (3S)-3-hydroxyacyl-CoA = trans-2(or 3)-enoyl-CoA + H(2)O].
Mycobrowser EC 4.2.1.17 · agrees with the atlas

The legacy Mycobrowser record is shown for verification. Mycobrowser is no longer maintained; its EC numbers predate recent nomenclature revisions, so a class change usually reflects re-numbering, not a conflict.

Orthologues (reciprocal best hits across mycobacteria)

M. bovis Mb0649c · 100.0% identity
M. marinum MMAR_0962 · 84.8% identity
M. smegmatis MSMEG_1331 · 56.0% identity
M. orygis RJtmp_000663 · 100.0% identity

Reciprocal-best-hit orthologues (DIAMOND) against the Mycobrowser reference proteomes. A missing species is informative: e.g. a gene absent from M. leprae was likely lost in its reductive genome evolution. Locus tags link to Mycobrowser.

Curated reference (UniProt)

UniProt I6Y8B5 TrEMBL · unreviewed · Evidence at protein level
UniProt nameProbable enoyl-CoA hydratase EchA3

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category I Lipid transport and metabolism
Preferred nameechA3
eggNOG descriptionEnoyl-CoA hydratase
Orthologous groupCOG1024
EC number EC 4.2.1.17
KEGG orthology K01692
KEGG pathways map00071, map00280, map00281, map00310, map00360, map00362, map00380, map00410, map00627, map00640, map00650, map00903, map00930, map01100, map01110, map01120, map01130, map01212
KEGG modules M00032, M00087

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.665 · relaxed/neutral
Polymorphic sites (≥ 0.1% of strains) 2 synonymous, 4 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Outgroup conservation (beyond the MTBC) Corynebacteriales

Genus-wide presence (~53 non-MTBC Mycobacterium) present in 53/53 (100%) · mean identity 83.0% · 4/4 closest MTBAP relatives
conserved across the genus (present in 53/53 non-MTBC Mycobacterium genomes, incl. distant relatives) — an ancient core gene predating the genus radiation
Phylostratum (deepest detected homolog) MTBC-specific Mycobacterium Mycobacteriaceae Corynebacteriales Actinomycetia Bacteria
detected in 3/13 non-Mycobacterium reference genomes (down to Corynebacteriales) · mean identity 32.3%
detected across the order Corynebacteriales (Corynebacterium/Nocardia/Rhodococcus/…) but not in more distant Actinomycetia — a Corynebacteriales-level gene

Two orthogonal outgroup signals. M. canettii (the immediate outgroup) gives a deep-divergence dN/dS (a low value confirms a constrained, real gene; shown as confident only at ≥8 substitutions, else flagged low-power). Genus-wide presence/absence (tblastn vs assembled non-MTBC genomes) places the gene on the ancient-core ↔ MTBC-specific axis: a gene absent even from the closest MTBAP relatives is a candidate MTBC-specific innovation (possible host-adaptation factor, to confirm by synteny). The phylostratum extends that axis outside the genus (tblastn vs 13 reference genomes spanning Mycobacteriaceae → Corynebacteriales → Actinomycetia → outside the phylum): it is the deepest clade in which a homolog is still detected, i.e. a proxy for gene age. Read it with the null model in mind: a shallow (young) stratum can also reflect homology-detection failure for short or fast-evolving ORFs, so it is a descriptive axis, not a proof of novelty.

Essentiality (transposon mutagenesis)

DeJesus 2017 callNE · non-essential
What the call meansnon-essential
TA sites (Himar1) 14 in the ORF — 0 in the essential state, 0 growth-defect, 14 non-essential, 0 growth-advantage. Saturation 1.000, mean read count 93.7857142857. A region of the protein devoid of TA sites is invisible to this assay: nothing can be inferred about it, in either direction.

Genome-wide Himar1 transposon essentiality in H37Rv (DeJesus 2017). An essential call (ES/ESD/GD) is strong, independent evidence that a "hypothetical" locus encodes a functional, selectively required gene — orthogonal to intra-species conservation.

Mutant phenotypes (conditional Tn-seq, MtbTnDB)

Conditionlog2FCqEffect
altered fitness under 6 weeks hypoxia (stress) +1.170.024 disruption advantageous

Conditional fitness of transposon-disruption mutants across 1 significant condition(s) (|log2FC|≥1, q≤0.05), from the standardized MtbTnDB compendium. A negative log2FC means the mutant is depleted — the gene contributes to fitness in that condition. An in-vivo defect for a "hypothetical" is strong evidence it matters for infection, even without a known molecular function. Disruption (Tn insertion), not a clean deletion; genetic-interaction screens excluded.

Proteomics (mass spectrometry) detected

MS detectiondetected in 15 of 16 independent MS datasets
Integrated abundance1884.0 ppm · rank 89/3519 (97.5th percentile)

Detection by mass spectrometry is direct, experimental evidence that the protein product exists — orthogonal to sequence conservation and to Tn-seq essentiality, and especially decisive for a "hypothetical" locus. Reproducible detection across several independent datasets (PaxDb) makes the existence claim robust; the integrated abundance places the protein in the proteome's dynamic range.

Physico-chemical properties (computed, ProtParam)

Length231 aa
Molecular weight24.4 kDa
Theoretical pI5.52
GRAVY0.206 (hydrophobic)
Aliphatic index97.8
Aromaticity0.065
Instability index31.5 (stable)

Computed from the ancestral MTBC0 sequence with the ExPASy ProtParam method (Biopython). Descriptive biophysical context: a positive GRAVY flags a hydrophobic (often membrane) protein, a high instability index (>40) predicts a short in-vitro half-life, an extreme pI hints at compartment or binding partner.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
ECH_1PF00378.26 1.5e-279–207 Enoyl-CoA hydratase/isomerase
ECH_2PF16113.11 6.5e-1422–136 Enoyl-CoA hydratase/isomerase

Experimental structures (Protein Data Bank) 5 solved

PDBMethodResolutionCoverage
4fn7 X-ray diffraction 1.25 Å 100%
4fnb X-ray diffraction 1.8 Å 100%
4fn8 X-ray diffraction 1.831 Å 100%
4fnd X-ray diffraction 1.85 Å 100%
4hc8 X-ray diffraction 2.51 Å 100%

Experimentally solved structures mapped from the UniProt accession via PDBe/SIFTS (5 total; up to 8 shown, ranked by sequence coverage then resolution). An experimental structure is direct proof of the folded product and the strongest structural evidence — superseding the predicted ESMFold/AlphaFold models below for any covered region.

Structural search (AlphaFold DB model, Foldseek vs PDB — genome-wide) pLDDT 97.4

PDB hitprobTM-scoreE-valueDescription
4hc8-assembly1_A 1.00 0.99 4.8e-42 sig 4hc8-assembly1_A CRYSTAL STRUCTURE OF PROBABLE ENOYL-CoA HYDRATASE ECHA3 (Rv0632c, NYSGRC-019494) from Mycobacterium Tuberculosis H37Rv
4fn7-assembly1_B 1.00 0.99 3.4e-42 sig 4fn7-assembly1_B Apo Structure of the Mtb enoyol CoA isomerase (Rv0632c)
3r6h-assembly1_A 1.00 0.99 5.7e-39 sig 3r6h-assembly1_A Crystal structure of an enoyl-CoA hydratase (ECHA3) from Mycobacterium marinum
6c7c-assembly1_B 1.00 0.99 1.4e-38 sig 6c7c-assembly1_B Crystal structure of Enoyl-CoA hydratase, EchA3, from Mycobacterium ulcerans Agy99
6sl9-assembly1_AAA 1.00 0.84 9.8e-17 sig 6sl9-assembly1_AAA High resolution apo structure of isomerase PaaG

Foldseek search of the AlphaFold DB model (mean pLDDT 97.4, gated at 70) against the PDB — a genome-wide extension of the ESMFold dark-gene search that also covers proteins beyond the single-sequence length limit. Confident structural neighbours (E < 0.01) shown.

Genomic context (neighbours & predicted operon) operon of 2

Upstream (5' on genome)recC (- strand, 276 bp gap)
Downstream (3' on genome)Rv0633c (- strand, 48 bp gap)
Predicted operon echA3 · Rv0633c

Neighbours from the H37Rv annotation (- strand). The operon is predicted by co-directional intergenic distance (same strand, gaps ≤50 bp) — a transcription-unit hypothesis, not a mapped TSS. For a "hypothetical", co-transcription with a characterised operon is a concrete functional lead (complements the STRING neighborhood channel below).

Transcriptional regulation (signed TRN: ChIP-seq + TFOE)

Regulated by (1 TF) Rv0324 (represses)

Regulatory edges from the ISB signed transcriptional regulatory network (TF ChIP-seq binding, Minch 2015 + TF-overexpression response, Rustad 2014). An edge is regulatory evidence (binding and/or expression change), not necessarily direct. For a "hypothetical", membership in a known regulon (e.g. DosR dormancy, PhoP virulence) is a strong physiological-context lead.

Functional interaction network (STRING v12, guilt-by-association)

Explore full network →

Node colour = verdict, dashed = hypothetical; edge colour = evidence (green experimental, orange genomic-context, grey co-expression), width ∝ score. Click a partner to open its page; "Explore full network" to walk the graph.

PartnerProductScoreNo text-miningChannels (≥400)
Rv0154c fadE2 exp acyl-CoA dehydrogenase FadE2 886 882 database:750
Rv0400c fadE7 exp acyl-CoA dehydrogenase FadE7 867 862 database:750
Rv3140 fadE23 exp acyl-CoA dehydrogenase FadE23 850 845 database:750
Rv0131c fadE1 exp acyl-CoA dehydrogenase FadE1 850 845 database:750
Rv2500c fadE19 exp acyl-CoA dehydrogenase FadE19 850 845 database:750
Rv0231 fadE4 exp acyl-CoA dehydrogenase FadE4 850 845 database:750
Rv0975c fadE13 exp acyl-CoA dehydrogenase FadE13 849 844 database:750
Rv0633c hyp hypothetical protein 817 818 ctx neighborhood:815
Rv0914c exp lipid carrier protein or keto acyl-CoA thiolase 798 790 database:447
Rv2524c fas fatty acid synthase 816 789 coexpression:646
Rv1627c exp nonspecific lipid-transfer protein 786 777 database:447
Rv1867 hyp exp hypothetical protein 776 776 database:447
Rv0951 sucC succinyl-CoA ligase subunit beta 782 771 coexpression:744
Rv1323 fadA4 exp acetyl-CoA acetyltransferase 767 758 coexpression:414 database:447
Rv0468 fadB2 exp 3-hydroxybutyryl-CoA dehydrogenase 766 757 database:650

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The exp badge marks an experimentally-supported partner (measured interaction, experimental/database channel ≥400) as opposed to a purely predicted one — but note that the M. tuberculosis experimental interactome is dominated by a noisy bacterial-two-hybrid screen, so a strong measured link that contradicts the operon/localisation context is likely a false positive. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: enoyl-CoA hydratase EchA3
  • MTBC0 PGAP product: crotonase/enoyl-CoA hydratase family protein
  • Pfam (hmmscan --cut_ga): ECH_1 PF00378.26 (E=2e-27), ECH_2 PF16113.11 (E=7e-14)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_215146.1)
  • Domains: Pfam-A via hmmscan --cut_ga — ECH_1 (PF00378.26), ECH_2 (PF16113.11)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG1024
  • Curated reference: UniProt I6Y8B5 (TrEMBL, unreviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Genome-wide structure: AlphaFold DB model (Jumper et al. 2021, doi:10.1038/s41586-021-03819-2; Varadi et al. 2024, doi:10.1093/nar/gkad1011) searched vs PDB with Foldseek (mean pLDDT 97.4)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 183 functional partner(s)
  • Essentiality: genome-wide transposon mutagenesis in H37Rv — DeJesus et al. 2017 (mBio, doi:10.1128/mBio.02133-16, CC BY)
  • Proteomics: integrated mass-spectrometry abundance from PaxDb 5.0 (Huang et al. 2023, doi:10.1016/j.mcpro.2023.100640), taxon 83332 — weighted average of 16 datasets, incl. Schubert et al. 2013 (doi:10.1016/j.chom.2013.04.008) and Albrethsen et al. 2013 (doi:10.1074/mcp.M112.018846)
  • Functional category: TubercuList scheme (Cole et al. 1998, doi:10.1038/31159), via Mycobrowser (Kapopoulou et al. 2011, doi:10.1016/j.tube.2010.09.006)
  • Orthologues: reciprocal best hits (DIAMOND, Buchfink et al. 2021, doi:10.1038/s41592-021-01101-x) against Mycobrowser release 5 reference proteomes
  • Experimental structures: PDBe/SIFTS UniProt→PDB mapping (Dana et al. 2019, doi:10.1093/nar/gky1114)
  • Genomic context / operon: H37Rv annotation; operon predicted by co-directional intergenic distance (Salgado et al. 2000, doi:10.1073/pnas.030539397)
  • Transcriptional regulation: ISB signed TRN — TF ChIP-seq (Minch et al. 2015, doi:10.1038/ncomms6829) + TF overexpression (Rustad et al. 2014, doi:10.1186/gb-2014-15-11-502)
  • Mutant phenotypes: standardized Tn-seq compendium MtbTnDB (Jinich et al. 2025, doi:10.1111/mmi.15370), aggregating many primary Tn-seq studies across conditions
  • Physico-chemical properties: ExPASy ProtParam method via Biopython (Gasteiger et al. 2005), computed from the MTBC0 sequence
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_000665|Rv0632c|echA3
MSDPVSYTRKDSIAVISMDDGKVNALGPAMQQALNAAIDNADRDDVGALVITGNGRVFSGGFDLKILTSGEVQPAIDMLRGGFELAYRLLSYPKPVVMACTGHAIAMGAFLLSCGDHRVAAHAYNIQANEVAIGMTIPYAALEIMKLRLTRSAYQQATGLAKTFFGETALAAGFIDEIALPEVVVSRAEEAAREFAGLNQHAHAATKLRSRADALTAIRAGIDGIAAEFGL