Rv1021 Resolved · high auto-curated

H37Rv Rv1021 · MTBC0 mtbc0_001097 · 325 aa · 1150008–1150985 (+) · RefSeq NP_215537.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)nucleoside triphosphate pyrophosphohydrolase
MTBC0 PGAP re-annotationnucleoside triphosphate pyrophosphohydrolase
Revised (this work)Nucleoside triphosphate pyrophosphohydrolase. Pfam: MazG_N (PF27510.1), MazG (PF03819.23).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt P96379 SwissProt · reviewed · Evidence at protein level
UniProt nameNucleoside triphosphate pyrophosphohydrolase
EC (curated) EC 3.6.1.8
Curated functionRequired to maintain the full capacity of the mycobacterium to respond to oxidative stress via the degradation of oxidation-induced damaged nucleotides. Hydrolyzes all canonical (d)NTPs, as well as mutagenic dUTP and 8-oxo-7,8-dihydro-2'-deoxyguanosine 5'-triphosphate (8-oxo-dGTP). Also involved in the transcriptional activation of RelA in response to oxidative stress.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category S Function unknown
Preferred namemazG
eggNOG descriptionpyrophosphohydrolase
Orthologous groupCOG1694
EC number EC 3.6.1.66
KEGG orthology K02428, K02499
KEGG pathways map00230
Gene Ontology (139) GO:0000287, GO:0003674, GO:0003824, GO:0005488, GO:0005575, GO:0005618, GO:0005623, GO:0006139, GO:0006163, GO:0006195, GO:0006203, GO:0006213 +127 more

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS n/a
Polymorphic sites (≥ 0.1% of strains) 0 synonymous, 1 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
MazG_NPF27510.1 3.1e-261–76 MazG N-terminal domain
MazGPF03819.23 5.6e-25107–181 MazG nucleotide pyrophosphohydrolase domain

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: mfd (transcription-repair coupling factor), high confidence from genomic context alone (score 887 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv3624c hpt hypoxanthine-guanine phosphoribosyltransferase 923 923 database:900
Rv1341 rdgB non-canonical purine NTP pyrophosphatase 916 916 database:900
Rv3411c guaB2 inosine-5'-monophosphate dehydrogenase 907 904 database:900
Rv3396c guaA GMP synthase 903 904 database:900
Rv1843c guaB1 inosine-5'-monophosphate dehydrogenase 906 901 database:900
Rv3410c guaB3 oxidoreductase 901 901 database:900
Rv2445c ndkA nucleoside diphosphate kinase 900 901 database:900
Rv1020 mfd transcription-repair coupling factor 958 887 ctx neighborhood:881 textmining:645
Rv1025 hyp hypothetical protein 686 687 ctx neighborhood:682
Rv1026 ppx2 hyp hypothetical protein 686 687 ctx neighborhood:682
Rv1019 transcriptional regulator 956 680 ctx neighborhood:678 textmining:870
Rv1022 lpqU lipoprotein LpqU 662 662 ctx neighborhood:657
Rv1023 eno enolase 569 553 ctx neighborhood:552
Rv1024 membrane protein 512 512 ctx neighborhood:507
Rv1274 lprB lipoprotein LprB 498 498 coexpression:457

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: nucleoside triphosphate pyrophosphohydrolase
  • MTBC0 PGAP product: nucleoside triphosphate pyrophosphohydrolase
  • Pfam (hmmscan --cut_ga): MazG_N PF27510.1 (E=3e-26), MazG PF03819.23 (E=6e-25)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_215537.1)
  • Domains: Pfam-A via hmmscan --cut_ga — MazG_N (PF27510.1), MazG (PF03819.23)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG1694
  • Curated reference: UniProt P96379 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 42 functional partner(s); context anchor mfd
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_001097|Rv1021|
MIVVLVDPRRPTLVPVEAIEFLRGEVQYTEEMPVAVPWSLPAARSAHAGNDAPVLLSSDPNHPAVITRLAAGARLISAPDSQRGERLVDAVAMMDKLRTAGPWESEQTHDSLRRYLLEETYELLDAVRSGSVDQLREELGDLLLQVLFHARIAEDASQSPFTIDDVADTLMRKLGNRAPGVLAGESISLEDQLAQWEAAKASEKARKSVADDVHTGQPALALAQKVIQRAQKAGLPAHLIPDEITSVSVSADVDAENTLRTAVLDFIDRLRCAERAIAVARRGSNVAEQLDVTPLGVITEQEWLAHWPTAVNDSRGGSKKRKGMR