adk Resolved · high auto-curated

H37Rv Rv0733 · MTBC0 mtbc0_000775 · 181 aa · 830315–830860 (+) · RefSeq NP_215247.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)adenylate kinase
MTBC0 PGAP re-annotationadenylate kinase
Revised (this work)Adenylate kinase. Pfam: AAA_33 (PF13671.13), AAA_18 (PF13238.13), ADK (PF00406.30), AAA_17 (PF13207.13).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt P9WKF5 SwissProt · reviewed · Evidence at protein level
UniProt nameAdenylate kinase
EC (curated) EC 2.7.4.3
Curated functionCatalyzes the reversible transfer of the terminal phosphate group between ATP and AMP. Plays an important role in cellular energy homeostasis and in adenine nucleotide metabolism. Has a broad specificity for nucleoside triphosphates, being highly active with ATP or dATP as phosphate donors, and less active with GTP or UTP.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category F Nucleotide transport and metabolism
Preferred nameadk
eggNOG descriptionCatalyzes the reversible transfer of the terminal phosphate group between ATP and AMP. Plays an important role in cellular energy homeostasis and in adenine nucleotide metabolism
Orthologous groupCOG0563
EC number EC 2.7.4.3
KEGG orthology K00939
KEGG pathways map00230, map00730, map01100, map01110, map01130
KEGG modules M00049
Gene Ontology (108) GO:0000166, GO:0003674, GO:0003824, GO:0004017, GO:0004550, GO:0005488, GO:0005524, GO:0005575, GO:0005618, GO:0005622, GO:0005623, GO:0005737 +96 more

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.0 · strong purifying
Polymorphic sites (≥ 0.1% of strains) 2 synonymous, 0 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
AAA_33PF13671.13 7.8e-103–145 AAA domain
AAA_18PF13238.13 8.3e-073–132 AAA domain
ADKPF00406.30 4.1e-535–158 Adenylate kinase
AAA_17PF13207.13 1.9e-316–137 AAA domain

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: secY (preprotein translocase SecY), high confidence from genomic context alone (score 989 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv0732 secY preprotein translocase SecY 994 989 ctx neighborhood:881 coexpression:912 textmining:507
Rv0734 mapA methionine aminopeptidase 985 984 ctx neighborhood:882 cooccurence:434 coexpression:750
Rv3459c rpsK 30S ribosomal protein S11 955 948 ctx cooccurence:507 coexpression:861
Rv1307 atpH ATP synthase subunit b/delta 959 944 coexpression:943
Rv0777 purB adenylosuccinate lyase PurB 971 943 database:900 textmining:517
Rv2584c apt adenine phosphoribosyltransferase 961 940 database:900
Rv0716 rplE 50S ribosomal protein L5 947 936 coexpression:885
Rv1617 pykA pyruvate kinase 940 930 database:900
Rv2445c ndkA nucleoside diphosphate kinase 943 926 database:900
Rv2202c adoK adenosine kinase 974 920 database:900 textmining:691
Rv0714 rplN 50S ribosomal protein L14 930 917 coexpression:865
Rv3624c hpt hypoxanthine-guanine phosphoribosyltransferase 940 916 ctx fusion:887
Rv0721 rpsE 30S ribosomal protein S5 925 915 coexpression:865
Rv0704 rplB 50S ribosomal protein L2 932 911 coexpression:871
Rv0701 rplC 50S ribosomal protein L3 925 911 coexpression:845

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: adenylate kinase
  • MTBC0 PGAP product: adenylate kinase
  • Pfam (hmmscan --cut_ga): AAA_33 PF13671.13 (E=8e-10), AAA_18 PF13238.13 (E=8e-07), ADK PF00406.30 (E=4e-53), AAA_17 PF13207.13 (E=2e-31)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_215247.1)
  • Domains: Pfam-A via hmmscan --cut_ga — AAA_33 (PF13671.13), AAA_18 (PF13238.13), ADK (PF00406.30), AAA_17 (PF13207.13)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG0563
  • Curated reference: UniProt P9WKF5 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 185 functional partner(s); context anchor secY
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_000775|Rv0733|adk
MRVLLLGPPGAGKGTQAVKLAEKLGIPQISTGELFRRNIEEGTKLGVEAKRYLDAGDLVPSDLTNELVDDRLNNPDAANGFILDGYPRSVEQAKALHEMLERRGTDIDAVLEFRVSEEVLLERLKGRGRADDTDDVILNRMKVYRDETAPLLEYYRDQLKTVDAVGTMDEVFARALRALGK