adk Resolved · high auto-curated
H37Rv Rv0733 · MTBC0 mtbc0_000775 ·
181 aa ·
830315–830860 MTBC0
(+) ·
RefSeq NP_215247.1
Genomic neighbourhood (genome browser)
Open in full genome browser →This gene (outlined) in its genomic context; arrows are neighbouring genes coloured by verdict. Click any gene to navigate. Pan and zoom in the full browser.
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | adenylate kinase |
|---|---|
| MTBC0 PGAP re-annotation | adenylate kinase |
| Revised (this work) | Adenylate kinase. Pfam: AAA_33 (PF13671.13), AAA_18 (PF13238.13), ADK (PF00406.30), AAA_17 (PF13207.13). |
| Functional category (TubercuList) | intermediary metabolism and respiration |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
In the literature (TB corpus sweep) 14 publications
14 TB publications mention this gene. 14 publication(s) discuss this gene (15 in a M. tuberculosis context, 1 in other mycobacteria — M. marinum (1)).
| Publication | Date |
|---|---|
| NMR-driven insights into the evolutionary adaptation and dynamic regulation of Mycobacterium tuberculosis adenylate kinase: The critical role of glycine-mediated flexibility. doi:10.1016/j.bbrc.2026.153357 | 2026 |
| Red-eared slider turtle-Mycobacterium marinum infection model. doi:10.1128/iai.00315-25 | 2025 |
| Mycobacteria-Specific T Cells May Be Expanded From Healthy Donors and Are Near Absent in Primary Immunodeficiency Disorders. doi:10.3389/fimmu.2019.00621 | 2019 |
| Multi-locus sequence types of Mycoplasma bovis isolated from Ontario, Canada in the past three decades have a temporal distribution. doi:10.1177/1040638717731491 | 2018 |
| Adenylate kinase: a novel antigen for immunodiagnosis and subunit vaccine against tuberculosis. doi:10.1007/s00109-016-1392-5 | 2016 |
This layer CITES the literature and adds context; it does not change the verdict or the function stated elsewhere in this fiche. This distinguishes a gene that is dark because nobody has looked from one that is dark despite having been studied. Source: PubMed (whole): H37Rv locus tag + GENE NAME + ortholog identifiers (Mb…, MMAR_…, MSMEG_…, ML…, MAB_…), under a mycobacterial context filter; hits verified against the abstract text. Species-context counts distinguish M. tuberculosis literature from literature on other mycobacteria. phase76/phase77, 2026-07-13.
Genomic-neighbour overlap (structural caveat) co-directional · 1 % of gene
| Neighbour | secY (Rv0732, + strand) |
|---|---|
| Overlap | 4 bp, 1 % of this gene's length |
co-directional overlap: ordinary (e.g. shared stop/start codons in an operon), not the Rv2438A-type artefact P20.1, derived from GFF3 gene coordinates, 2026-08-03.
CRISPRi vulnerability
Vulnerability index -7.74 (95% CI -13.97 to -0.95). A more negative index = more vulnerable to knockdown (better drug-target quality); indicative threshold VI ≤ -6 = highly vulnerable.
Quantitative CRISPRi knockdown, graded (finer than binary Tn-seq essentiality). Source: CRISPRi vulnerability index (Bosch 2021, pebble.rockefeller.edu).
Legacy record & comparison (Mycobrowser)
| Mycobrowser function | This small ubiquitous enzyme is essential in intracellular nucleotide metabolism, in addition it has been found to act as both a nucleoside mono- and DI-phosphate kinase suggesting it may have a role in RNA and DNA biosynthesis [catalytic activity: ATP + AMP = ADP + ADP]. |
|---|---|
| Mycobrowser EC |
2.7.4.3
· agrees with the atlas
|
The legacy Mycobrowser record is shown for verification. Mycobrowser is no longer maintained; its EC numbers predate recent nomenclature revisions, so a class change usually reflects re-numbering, not a conflict.
Orthologues (reciprocal best hits across mycobacteria)
| M. bovis |
Mb0754
· 99.4% identity |
|---|---|
| M. leprae |
ML1832c
· 84.0% identity |
| M. marinum |
MMAR_1071
· 85.6% identity |
| M. smegmatis |
MSMEG_1484
· 77.9% identity |
| M. orygis |
RJtmp_000771
· 99.4% identity |
| M. abscessus |
MAB_3783c
· 70.2% identity |
Reciprocal-best-hit orthologues (DIAMOND) against the Mycobrowser reference proteomes. A missing species is informative: e.g. a gene absent from M. leprae was likely lost in its reductive genome evolution. Locus tags link to Mycobrowser.
Curated reference (UniProt)
| UniProt |
P9WKF5
SwissProt · reviewed
· Evidence at protein level
|
|---|---|
| UniProt name | Adenylate kinase |
| EC (curated) |
EC 2.7.4.3
|
| Curated function | Catalyzes the reversible transfer of the terminal phosphate group between ATP and AMP. Plays an important role in cellular energy homeostasis and in adenine nucleotide metabolism. Has a broad specificity for nucleoside triphosphates, being highly active with ATP or dATP as phosphate donors, and less active with GTP or UTP. |
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
F Nucleotide transport and metabolism
|
|---|---|
| Preferred name | adk |
| eggNOG description | Catalyzes the reversible transfer of the terminal phosphate group between ATP and AMP. Plays an important role in cellular energy homeostasis and in adenine nucleotide metabolism |
| Orthologous group | COG0563 |
| EC number |
EC 2.7.4.3
|
| KEGG orthology |
K00939
|
| KEGG pathways |
map00230, map00730, map01100, map01110, map01130
|
| KEGG modules |
M00049
|
| Gene Ontology (108) |
GO:0000166, GO:0003674, GO:0003824, GO:0004017, GO:0004550, GO:0005488, GO:0005524, GO:0005575, GO:0005618, GO:0005622, GO:0005623, GO:0005737 +96 more
|
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS | 0.0 · strong purifying |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 2 synonymous, 0 missense, 0 nonsense, 0 frameshift |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Outgroup conservation (beyond the MTBC) Bacteria
| Genus-wide presence (~53 non-MTBC Mycobacterium) |
present in 53/53 (100%) · mean identity 86.8%
· 4/4 closest MTBAP relatives conserved across the genus (present in 53/53 non-MTBC Mycobacterium genomes, incl. distant relatives) — an ancient core gene predating the genus radiation |
|---|---|
| Phylostratum (deepest detected homolog) |
MTBC-specific → Mycobacterium → Mycobacteriaceae → Corynebacteriales → Actinomycetia → Bacteria detected in 13/13 non-Mycobacterium reference genomes (down to Bacteria) · mean identity 54.9% detected down to outside the phylum (Proteobacteria/Firmicutes controls) — a universally conserved, ancient bacterial gene |
Two orthogonal outgroup signals. M. canettii (the immediate outgroup) gives a deep-divergence dN/dS (a low value confirms a constrained, real gene; shown as confident only at ≥8 substitutions, else flagged low-power). Genus-wide presence/absence (tblastn vs assembled non-MTBC genomes) places the gene on the ancient-core ↔ MTBC-specific axis: a gene absent even from the closest MTBAP relatives is a candidate MTBC-specific innovation (possible host-adaptation factor, to confirm by synteny). The phylostratum extends that axis outside the genus (tblastn vs 13 reference genomes spanning Mycobacteriaceae → Corynebacteriales → Actinomycetia → outside the phylum): it is the deepest clade in which a homolog is still detected, i.e. a proxy for gene age. Read it with the null model in mind: a shallow (young) stratum can also reflect homology-detection failure for short or fast-evolving ORFs, so it is a descriptive axis, not a proof of novelty.
Essentiality (transposon mutagenesis)
| DeJesus 2017 call | NE · non-essential |
|---|---|
| What the call means | non-essential |
| TA sites (Himar1) | 6 in the ORF — 0 in the essential state, 0 growth-defect, 6 non-essential, 0 growth-advantage. Saturation 0.167, mean read count 140. A region of the protein devoid of TA sites is invisible to this assay: nothing can be inferred about it, in either direction. |
| Caveat | Read with some caution: only 6 TA (Himar1) sites in the whole ORF (atlas median 13). The DeJesus 2017 call rests on fewer independent observations than for a longer gene. If this gene overlaps a neighbour (see Genomic-neighbour overlap section below), some of these 6 sites may fall inside the neighbour's ORF rather than its own, leaving even fewer truly informative sites than the raw count suggests. (P20.3) |
Genome-wide Himar1 transposon essentiality in H37Rv (DeJesus 2017). An essential call (ES/ESD/GD) is strong, independent evidence that a "hypothetical" locus encodes a functional, selectively required gene — orthogonal to intra-species conservation.
Chemical-genetic target & druggability (PROSPECT) hypomorph tool strain
This gene is part of the PROSPECT collection of TetON transcriptional-knockdown (hypomorph) strains of essential M. tuberculosis genes, built as a sensitised background for chemical-genetic mechanism-of-action deconvolution. Being in the panel means the gene is an essential / vulnerable target for which a validated knockdown tool strain exists.
| Hypomorph strain | Rv0733-adk_TetOn18.3 (TetON promoter 18) |
|---|---|
| Baseline knockdown fitness | 3.828 median doublings (across 6 screen pool(s)) — fewer doublings = stronger growth defect on knockdown |
| Used in target deconvolution | yes (informs phenotypic-cluster / MOA assignment) |
Panel membership reflects essentiality/vulnerability and the availability of a genetic tool, not a specific molecular function; it never changes the verdict here. Source: Bond AN et al., Nat Commun 2025;16:9673 (doi:10.1038/s41467-025-64662-x); PROSPECT chemical-genetic platform.
Proteomics (mass spectrometry) detected
| MS detection | detected in 16 of 16 independent MS datasets |
|---|---|
| Integrated abundance | 1769.0 ppm · rank 107/3519 (97.0th percentile) |
Detection by mass spectrometry is direct, experimental evidence that the protein product exists — orthogonal to sequence conservation and to Tn-seq essentiality, and especially decisive for a "hypothetical" locus. Reproducible detection across several independent datasets (PaxDb) makes the existence claim robust; the integrated abundance places the protein in the proteome's dynamic range.
Physico-chemical properties (computed, ProtParam)
| Length | 181 aa |
|---|---|
| Molecular weight | 20.1 kDa |
| Theoretical pI | 5.02 |
| GRAVY | -0.411 (hydrophilic) |
| Aliphatic index | 98.1 |
| Aromaticity | 0.05 |
| Instability index | 21.5 (stable) |
Computed from the ancestral MTBC0 sequence with the ExPASy ProtParam method (Biopython). Descriptive biophysical context: a positive GRAVY flags a hydrophobic (often membrane) protein, a high instability index (>40) predicts a short in-vitro half-life, an extreme pI hints at compartment or binding partner.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
AAA_33 | PF13671.13 | 7.8e-10 | 3–145 | AAA domain |
AAA_18 | PF13238.13 | 8.3e-07 | 3–132 | AAA domain |
ADK | PF00406.30 | 4.1e-53 | 5–158 | Adenylate kinase |
AAA_17 | PF13207.13 | 1.9e-31 | 6–137 | AAA domain |
Experimental structures (Protein Data Bank) 2 solved
| PDB | Method | Resolution | Coverage |
|---|---|---|---|
2cdn |
X-ray diffraction | 1.9 Å | 100% |
1p4s |
Solution NMR | — | 100% |
Experimentally solved structures mapped from the UniProt accession via PDBe/SIFTS (2 total; up to 8 shown, ranked by sequence coverage then resolution). An experimental structure is direct proof of the folded product and the strongest structural evidence — superseding the predicted ESMFold/AlphaFold models below for any covered region.
Structural search (AlphaFold DB model, Foldseek vs PDB — genome-wide) pLDDT 95.6
| PDB hit | prob | TM-score | E-value | Description |
|---|---|---|---|---|
2cdn-assembly1_A |
1.00 | 0.99 | 3.2e-31 sig | 2cdn-assembly1_A Crystal structure of Mycobacterium tuberculosis adenylate kinase complexed with two molecules of ADP and Mg |
5g3y-assembly1_A |
1.00 | 0.96 | 1.1e-21 sig | 5g3y-assembly1_A Crystal structure of adenylate kinase ancestor 1 with Zn and ADP bound |
2eu8-assembly2_B |
1.00 | 0.96 | 4.2e-20 sig | 2eu8-assembly2_B Crystal structure of a thermostable mutant of Bacillus subtilis Adenylate Kinase (Q199R) |
2p3s-assembly1_A |
1.00 | 0.96 | 2.3e-20 sig | 2p3s-assembly1_A Crystal structure of a thermostable mutant of Bacillus subtilis Adenylate Kinase (G214R/Q199R) |
1zip-assembly1_A |
1.00 | 0.96 | 4.5e-20 sig | 1zip-assembly1_A BACILLUS STEAROTHERMOPHILUS ADENYLATE KINASE |
Foldseek search of the AlphaFold DB model (mean pLDDT 95.6, gated at 70) against the PDB — a genome-wide extension of the ESMFold dark-gene search that also covers proteins beyond the single-sequence length limit. Confident structural neighbours (E < 0.01) shown.
Genomic context (neighbours & predicted operon) operon of 3
| Upstream (5' on genome) | secY (+ strand, -4 bp gap) |
|---|---|
| Downstream (3' on genome) | mapA (+ strand, 2 bp gap) |
| Predicted operon |
secY · adk · mapA
|
Neighbours from the H37Rv annotation (+ strand). The operon is predicted by co-directional intergenic distance (same strand, gaps ≤50 bp) — a transcription-unit hypothesis, not a mapped TSS. For a "hypothetical", co-transcription with a characterised operon is a concrete functional lead (complements the STRING neighborhood channel below).
Functional interaction network (STRING v12, guilt-by-association)
Explore full network →Node colour = verdict, dashed = hypothetical; edge colour = evidence (green experimental, orange genomic-context, grey co-expression), width ∝ score. Click a partner to open its page; "Explore full network" to walk the graph.
Closest characterised functional partner: secY (preprotein translocase SecY), high confidence from genomic context alone (score 989 excluding text-mining).
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv0732 secY |
preprotein translocase SecY | 994 | 989 ctx | neighborhood:881 coexpression:912 textmining:507 |
Rv0734 mapA |
methionine aminopeptidase | 985 | 984 ctx | neighborhood:882 cooccurence:434 coexpression:750 |
Rv3459c rpsK |
30S ribosomal protein S11 | 955 | 948 ctx | cooccurence:507 coexpression:861 |
Rv1307 atpH |
ATP synthase subunit b/delta | 959 | 944 | coexpression:943 |
Rv0777 purB exp |
adenylosuccinate lyase PurB | 971 | 943 | database:900 textmining:517 |
Rv2584c apt exp |
adenine phosphoribosyltransferase | 961 | 940 | database:900 |
Rv0716 rplE |
50S ribosomal protein L5 | 947 | 936 | coexpression:885 |
Rv1617 pykA exp |
pyruvate kinase | 940 | 930 | database:900 |
Rv2445c ndkA exp |
nucleoside diphosphate kinase | 943 | 926 | database:900 |
Rv2202c adoK exp |
adenosine kinase | 974 | 920 | database:900 textmining:691 |
Rv0714 rplN |
50S ribosomal protein L14 | 930 | 917 | coexpression:865 |
Rv3624c hpt |
hypoxanthine-guanine phosphoribosyltransferase | 940 | 916 ctx | fusion:887 |
Rv0721 rpsE |
30S ribosomal protein S5 | 925 | 915 | coexpression:865 |
Rv0704 rplB |
50S ribosomal protein L2 | 932 | 911 | coexpression:871 |
Rv0701 rplC |
50S ribosomal protein L3 | 925 | 911 | coexpression:845 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The exp badge marks an experimentally-supported partner (measured interaction, experimental/database channel ≥400) as opposed to a purely predicted one — but note that the M. tuberculosis experimental interactome is dominated by a noisy bacterial-two-hybrid screen, so a strong measured link that contradicts the operon/localisation context is likely a false positive. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Legacy H37Rv annotation: adenylate kinase
- MTBC0 PGAP product: adenylate kinase
- Pfam (hmmscan --cut_ga): AAA_33 PF13671.13 (E=8e-10), AAA_18 PF13238.13 (E=8e-07), ADK PF00406.30 (E=4e-53), AAA_17 PF13207.13 (E=2e-31)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_215247.1)
- Domains: Pfam-A via hmmscan --cut_ga — AAA_33 (PF13671.13), AAA_18 (PF13238.13), ADK (PF00406.30), AAA_17 (PF13207.13)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
COG0563 - Curated reference: UniProt P9WKF5 (SwissProt, reviewed; Evidence at protein level)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Genome-wide structure: AlphaFold DB model (Jumper et al. 2021, doi:10.1038/s41586-021-03819-2; Varadi et al. 2024, doi:10.1093/nar/gkad1011) searched vs PDB with Foldseek (mean pLDDT 95.6)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
185 functional partner(s); context anchor
secY - Essentiality: genome-wide transposon mutagenesis in H37Rv — DeJesus et al. 2017 (mBio, doi:10.1128/mBio.02133-16, CC BY)
- Proteomics: integrated mass-spectrometry abundance from PaxDb 5.0 (Huang et al. 2023, doi:10.1016/j.mcpro.2023.100640), taxon 83332 — weighted average of 16 datasets, incl. Schubert et al. 2013 (doi:10.1016/j.chom.2013.04.008) and Albrethsen et al. 2013 (doi:10.1074/mcp.M112.018846)
- Functional category: TubercuList scheme (Cole et al. 1998, doi:10.1038/31159), via Mycobrowser (Kapopoulou et al. 2011, doi:10.1016/j.tube.2010.09.006)
- Orthologues: reciprocal best hits (DIAMOND, Buchfink et al. 2021, doi:10.1038/s41592-021-01101-x) against Mycobrowser release 5 reference proteomes
- Experimental structures: PDBe/SIFTS UniProt→PDB mapping (Dana et al. 2019, doi:10.1093/nar/gky1114)
- Genomic context / operon: H37Rv annotation; operon predicted by co-directional intergenic distance (Salgado et al. 2000, doi:10.1073/pnas.030539397)
- Physico-chemical properties: ExPASy ProtParam method via Biopython (Gasteiger et al. 2005), computed from the MTBC0 sequence
- Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>mtbc0_000775|Rv0733|adk MRVLLLGPPGAGKGTQAVKLAEKLGIPQISTGELFRRNIEEGTKLGVEAKRYLDAGDLVPSDLTNELVDDRLNNPDAANGFILDGYPRSVEQAKALHEMLERRGTDIDAVLEFRVSEEVLLERLKGRGRADDTDDVILNRMKVYRDETAPLLEYYRDQLKTVDAVGTMDEVFARALRALGK
Spot an error? Suggest an improvement
Found a mistake, a missing reference, or have a better functional hypothesis for adk? Email the maintainer — the message is pre-filled with this gene's details.