guaB2 Resolved · high auto-curated

H37Rv Rv3411c · MTBC0 mtbc0_003625 · 529 aa · 3855369–3856958 (-) · RefSeq NP_217928.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)inosine-5'-monophosphate dehydrogenase
MTBC0 PGAP re-annotationIMP dehydrogenase
Revised (this work)IMP dehydrogenase. Pfam: IMPDH (PF00478.32), CBS (PF00571.34).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt P9WKI7 SwissProt · reviewed · Evidence at protein level
UniProt nameInosine-5'-monophosphate dehydrogenase
EC (curated) EC 1.1.1.205
Curated functionCatalyzes the conversion of inosine 5'-phosphate (IMP) to xanthosine 5'-phosphate (XMP), the first committed and rate-limiting step in the de novo synthesis of guanine nucleotides, and therefore plays an important role in the regulation of cell growth. Does not catalyze the reverse reaction, i.e. the conversion of XMP to IMP. Appears to be essential for the optimal growth of M.tuberculosis.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category F Nucleotide transport and metabolism
Preferred nameguaB
eggNOG descriptionCatalyzes the conversion of inosine 5'-phosphate (IMP) to xanthosine 5'-phosphate (XMP), the first committed and rate- limiting step in the de novo synthesis of guanine nucleotides, and therefore plays an important role in the regulation of cell growth
Orthologous groupCOG0516
EC number EC 1.1.1.205
KEGG orthology K00088
KEGG pathways map00230, map00983, map01100, map01110
KEGG modules M00050
Gene Ontology (122) GO:0003674, GO:0003824, GO:0003938, GO:0005575, GO:0005618, GO:0005622, GO:0005623, GO:0005737, GO:0005886, GO:0006139, GO:0006163, GO:0006164 +110 more

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.24 · purifying
Polymorphic sites (≥ 0.1% of strains) 6 synonymous, 4 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
IMPDHPF00478.32 1.2e-15344–515 IMP dehydrogenase / GMP reductase domain
CBSPF00571.34 5.6e-10129–176 CBS domain

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: guaA (GMP synthase), high confidence from genomic context alone (score 999 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv3396c guaA GMP synthase 999 999 ctx neighborhood:544 cooccurence:665 coexpression:952 database:900 textmining:942
Rv3410c guaB3 oxidoreductase 989 982 ctx neighborhood:789 database:900 textmining:417
Rv0357c purA adenylosuccinate synthetase 993 974 coexpression:645 database:900 textmining:753
Rv0957 purH bifunctional phosphoribosylaminoimidazolecarboxamide formyltransferase/inosinemonophosphate cyclohydrolase 972 958 coexpression:421 database:900
Rv1843c guaB1 inosine-5'-monophosphate dehydrogenase 960 928 database:900 textmining:474
Rv1341 rdgB non-canonical purine NTP pyrophosphatase 935 928 database:900
Rv3624c hpt hypoxanthine-guanine phosphoribosyltransferase 990 910 database:900 textmining:893
Rv1021 mazG nucleoside triphosphate pyrophosphohydrolase 907 904 database:900
Rv0808 purF amidophosphoribosyltransferase 940 890 coexpression:833 textmining:478
Rv3409c choD cholesterol oxidase 806 794 ctx neighborhood:791
Rv3412 hyp hypothetical protein 760 760 ctx neighborhood:756
Rv1650 pheT phenylalanine--tRNA ligase subunit beta 788 723 coexpression:713
Rv0777 purB adenylosuccinate lyase PurB 943 708 coexpression:648 textmining:814
Rv0667 rpoB DNA-directed RNA polymerase subunit beta 693 648 coexpression:648
Rv2861c mapB methionine aminopeptidase 690 644 database:478

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: inosine-5'-monophosphate dehydrogenase
  • MTBC0 PGAP product: IMP dehydrogenase
  • Pfam (hmmscan --cut_ga): IMPDH PF00478.32 (E=1e-153), CBS PF00571.34 (E=6e-10)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_217928.1)
  • Domains: Pfam-A via hmmscan --cut_ga — IMPDH (PF00478.32), CBS (PF00571.34)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG0516
  • Curated reference: UniProt P9WKI7 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 150 functional partner(s); context anchor guaA
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_003625|Rv3411c|guaB2
MSRGMSGLEDSSDLVVSPYVRMGGLTTDPVPTGGDDPHKVAMLGLTFDDVLLLPAASDVVPATADTSSQLTKKIRLKVPLVSSAMDTVTESRMAIAMARAGGMGVLHRNLPVAEQAGQVEMVKRSEAGMVTDPVTCRPDNTLAQVDALCARFRISGLPVVDDDGALVGIITNRDMRFEVDQSKQVAEVMTKAPLITAQEGVSASAALGLLRRNKIEKLPVVDGRGRLTGLITVKDFVKTEQHPLATKDSDGRLLVGAAVGVGGDAWVRAMMLVDAGVDVLVVDTAHAHNRLVLDMVGKLKSEVGDRVEVVGGNVATRSAAAALVDAGADAVKVGVGPGSICTTRVVAGVGAPQITAILEAVAACRPAGVPVIADGGLQYSGDIAKALAAGASTAMLGSLLAGTAEAPGELIFVNGKQYKSYRGMGSLGAMRGRGGATSYSKDRYFADDALSEDKLVPEGIEGRVPFRGPLSSVIHQLTGGLRAAMGYTGSPTIEVLQQAQFVRITPAGLKESHPHDVAMTVEAPNYYAR