Rv2474c Family assigned · low

H37Rv Rv2474c · MTBC0 mtbc0_002636 · 217 aa · 2800564–2801217 (-) · RefSeq NP_216990.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)hypothetical protein
MTBC0 PGAP re-annotationhypothetical protein
Revised (this work)DnaN/beta-sliding-clamp-like fold; distinct from the genuine DNA polymerase III beta clamp dnaN/Rv0002 (fold-paralogue safeguard). Function of this paralogue undetermined.

Curated reference (UniProt)

UniProt I6X4D6 TrEMBL · unreviewed · Evidence at protein level
UniProt nameUncharacterized protein

UniProt still lists this protein as Uncharacterized protein; the revised annotation above is ahead of the current UniProt record.

Functional vocabulary (eggNOG-mapper, orthology transfer)

Orthologous group2DQ1M

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.756 · relaxed/neutral
Polymorphic sites (≥ 0.1% of strains) 2 synonymous, 4 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
DUF8010PF26035.1 4.2e-361–100 Domain of unknown function (DUF8010)
DUF8185PF26572.1 3.0e-30103–210 Domain of unknown function (DUF8185)

Structural neighbours (Foldseek on the ESMFold model, exploratory)

ESMFold model confidence: mean pLDDT 92.6 (very high). A confident model makes the fold comparison meaningful.

Best matches against the PDB, ranked by Foldseek homology probability. A high probability / TM-score suggests a shared fold; unless flagged sig (E < 0.01) these are fold hypotheses, not assignments.

TargetProbTME-valueDescription
6fvl-assembly1_B 1.00 0.57 9.2e-07 sig 6fvl-assembly1_B DNA polymerase sliding clamp from Escherichia coli with bound P7 peptide
8dt6-assembly1_B 1.00 0.58 1.2e-06 sig 8dt6-assembly1_B Crystal Structure of DNA Polymerase III beta subunit from Elizabethkingia anophelis
3t0p-assembly1_B 1.00 0.57 1.2e-06 sig 3t0p-assembly1_B Crystal structure of a Putative DNA polymerase III beta subunit (EUBREC_0002; ERE_29750) from Eubacterium rectale ATCC 33656 at 2.26 A resolution
6fvl-assembly2_D 1.00 0.55 6.9e-07 sig 6fvl-assembly2_D DNA polymerase sliding clamp from Escherichia coli with bound P7 peptide
3t0p-assembly1_A 1.00 0.57 1.9e-06 sig 3t0p-assembly1_A Crystal structure of a Putative DNA polymerase III beta subunit (EUBREC_0002; ERE_29750) from Eubacterium rectale ATCC 33656 at 2.26 A resolution
4n95-assembly1_B 1.00 0.53 4.6e-07 sig 4n95-assembly1_B E. coli sliding clamp in complex with 5-chloroindoline-2,3-dione
6fvm-assembly1_B 1.00 0.56 1.1e-06 sig 6fvm-assembly1_B Mutant DNA polymerase sliding clamp from Escherichia coli with bound P7 peptide
6jir-assembly1_A-2 1.00 0.52 2.9e-07 sig 6jir-assembly1_A-2 Crystal structure of C. crescentus beta sliding clamp with PEG bound to putative beta-motif tethering region

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: gdh (NAD-dependent glutamate dehydrogenase), high confidence from genomic context alone (score 889 excluding text-mining). This association is the citable seed of a function hypothesis for this hypothetical protein.

PartnerProductScoreNo text-miningChannels (≥400)
Rv2475c hyp hypothetical protein 904 904 ctx neighborhood:882
Rv2476c gdh NAD-dependent glutamate dehydrogenase 889 889 ctx neighborhood:881
Rv2477c ettA macrolide ABC transporter ATP-binding protein 773 773 ctx neighborhood:771
Rv3438 hyp hypothetical protein 757 757 ctx cooccurence:757
Rv2446c integral membrane protein 752 753 ctx cooccurence:746
Rv0358 hyp hypothetical protein 752 752 ctx cooccurence:752
Rv0556 transmembrane protein 751 752 ctx cooccurence:744
Rv0210 hyp hypothetical protein 750 750 ctx cooccurence:750
Rv0863 hyp hypothetical protein 748 748 ctx cooccurence:747
Rv3205c hyp hypothetical protein 747 748 ctx cooccurence:744
Rv1638A hyp hypothetical protein 733 734 ctx cooccurence:732
Rv1209 hyp hypothetical protein 715 716 ctx cooccurence:713
Rv3311 hyp hypothetical protein 714 715 ctx cooccurence:714
Rv3850 hyp hypothetical protein 713 714 ctx cooccurence:713
Rv3450c eccB4 ESX-4 secretion system protein EccB4 711 712 ctx cooccurence:710

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Foldseek vs AFDB-SwissProt: beta sliding clamp, TM 0.54, E 1e-5 (dnaN = Rv0002, not this locus)
  • Structural homology vs AlphaFold-Swiss-Prot (Foldseek; 542k curated SwissProt structures), project 'Still unknown gene function' phase13, 2026-06-10. Fold/family-level, not a demonstrated function.

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_216990.1)
  • Domains: Pfam-A via hmmscan --cut_ga — DUF8010 (PF26035.1), DUF8185 (PF26572.1)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG 2DQ1M
  • Curated reference: UniProt I6X4D6 (TrEMBL, unreviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Model confidence: ESMFold per-residue pLDDT (mean 92.6, very high)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 82 functional partner(s); context anchor gdh
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_002636|Rv2474c|
MVERGLWLPDPAHRADLATFVDHALRLDDAAVIRIRARSTGLLSAWVATGFDVLASRVVAGKVRPDDLSVAARSLAHGLATTDASGYVDPGYSMDSAWRGGLPPESGFTYLDDVPARVMLDLAHRGARLAKEHGSSAGPPVSLLDQEVIQVSSADVVVGLPMRCVFALTAMGFLPQSAETISADELIRVRISPAWLRLDARFGSVYRHRGHAALVLR