Rv3587c Family assigned · low
H37Rv Rv3587c · MTBC0 mtbc0_003806 ·
264 aa · 4052645–4053439 (-) ·
RefSeq NP_218104.1
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | membrane protein |
|---|---|
| MTBC0 PGAP re-annotation | hypothetical protein |
| Revised (this work) | Membrane/surface protein; its high-activity binding peptides bind alveolar epithelial (A549) and monocyte (U937) cells and inhibit M. tuberculosis invasion, implicating it in host-cell adhesion/invasion. Molecular function unfixed. |
Curated reference (UniProt)
| UniProt |
O53572
TrEMBL · unreviewed
· Evidence at protein level
|
|---|---|
| UniProt name | Probable conserved membrane protein |
Functional vocabulary (eggNOG-mapper, orthology transfer)
| Orthologous group | 2E5CN |
|---|
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS | 0.371 · purifying |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 2 synonymous, 2 missense, 0 nonsense, 0 frameshift |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Domains (Pfam, hmmscan --cut_ga)
No Pfam-A domain above the gathering threshold (or not yet scanned).
Functional interaction network (STRING v12, guilt-by-association)
Closest characterised functional partner: canB (carbonic anhydrase), high confidence from genomic context alone (score 771 excluding text-mining).
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv3258c hyp |
hypothetical protein | 798 | 798 | coexpression:798 |
Rv3588c canB |
carbonic anhydrase | 771 | 771 ctx | neighborhood:768 |
Rv3589 mutY |
A/G-specific adenine glycosylase | 721 | 721 ctx | neighborhood:713 |
Rv0010c |
membrane protein | 634 | 634 ctx | cooccurence:632 |
Rv3244c lpqB |
lipoprotein LpqB | 591 | 592 ctx | cooccurence:584 |
Rv0207c hyp |
hypothetical protein | 554 | 554 ctx | cooccurence:546 |
Rv1610 |
membrane protein | 551 | 552 ctx | cooccurence:549 |
Rv1100 hyp |
hypothetical protein | 546 | 546 ctx | cooccurence:544 |
Rv0635 hadA |
(3R)-hydroxyacyl-ACP dehydratase subunit HadA | 544 | 545 ctx | cooccurence:538 |
Rv3906c hyp |
hypothetical protein | 539 | 523 ctx | cooccurence:517 |
Rv2905 lppW |
lipoprotein LppW | 514 | 515 ctx | cooccurence:508 |
Rv0518 hyp |
hypothetical protein | 497 | 498 ctx | cooccurence:494 |
Rv3802c |
membrane protein | 493 | 493 ctx | cooccurence:490 |
Rv3035 hyp |
hypothetical protein | 492 | 492 ctx | cooccurence:475 |
Rv1275 lprC |
lipoprotein LprC | 478 | 478 ctx | cooccurence:459 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Surface membrane protein; HABPs inhibit mycobacterial entry (Carabali-Isajar 2018, PMID 29650461)
- Curated from the literature crible (project 'Still unknown gene function', 2026-06-09)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_218104.1)
- Domains: Pfam-A via hmmscan --cut_ga — none above threshold
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
2E5CN - Curated reference: UniProt O53572 (TrEMBL, unreviewed; Evidence at protein level)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
36 functional partner(s); context anchor
canB - Primary literature: Carabali-Isajar ML, Ocampo M, Rodriguez DC, Vanegas M, Curtidor H, Patarroyo MA, Patarroyo ME (2018). Towards designing a synthetic antituberculosis vaccine: The Rv3587c peptide inhibits mycobacterial entry to host cells Bioorg Med Chem 26(9):2401-2409. doi:10.1016/j.bmc.2018.03.044 PMID:29650461
Ancestral MTBC0 protein sequence
>mtbc0_003806|Rv3587c| MLDLEPRGPLPTEIYWRRRGLALGIAVVVVGIAVAIVIAFVDSSAGAKPVSADKPASAQSHPGSPAPQAPQPAGQTEGNAAAAPPQGQNPETPTPTAAVQPPPVLKEGDDCPDSTLAVKGLTNAPQYYVGDQPKFTMVVTNIGLVSCKRDVGAAVLAAYVYSLDNKRLWSNLDCAPSNETLVKTFSPGEQVTTAVTWTGMGSAPRCPLPRPAIGPGTYNLVVQLGNLRSLPVPFILNQPPPPPGPVPAPGPAQAPPPESPAQGG