Rv3587c Family assigned · low

H37Rv Rv3587c · MTBC0 mtbc0_003806 · 264 aa · 4052645–4053439 (-) · RefSeq NP_218104.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)membrane protein
MTBC0 PGAP re-annotationhypothetical protein
Revised (this work)Membrane/surface protein; its high-activity binding peptides bind alveolar epithelial (A549) and monocyte (U937) cells and inhibit M. tuberculosis invasion, implicating it in host-cell adhesion/invasion. Molecular function unfixed.

Curated reference (UniProt)

UniProt O53572 TrEMBL · unreviewed · Evidence at protein level
UniProt nameProbable conserved membrane protein

Functional vocabulary (eggNOG-mapper, orthology transfer)

Orthologous group2E5CN

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.371 · purifying
Polymorphic sites (≥ 0.1% of strains) 2 synonymous, 2 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

No Pfam-A domain above the gathering threshold (or not yet scanned).

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: canB (carbonic anhydrase), high confidence from genomic context alone (score 771 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv3258c hyp hypothetical protein 798 798 coexpression:798
Rv3588c canB carbonic anhydrase 771 771 ctx neighborhood:768
Rv3589 mutY A/G-specific adenine glycosylase 721 721 ctx neighborhood:713
Rv0010c membrane protein 634 634 ctx cooccurence:632
Rv3244c lpqB lipoprotein LpqB 591 592 ctx cooccurence:584
Rv0207c hyp hypothetical protein 554 554 ctx cooccurence:546
Rv1610 membrane protein 551 552 ctx cooccurence:549
Rv1100 hyp hypothetical protein 546 546 ctx cooccurence:544
Rv0635 hadA (3R)-hydroxyacyl-ACP dehydratase subunit HadA 544 545 ctx cooccurence:538
Rv3906c hyp hypothetical protein 539 523 ctx cooccurence:517
Rv2905 lppW lipoprotein LppW 514 515 ctx cooccurence:508
Rv0518 hyp hypothetical protein 497 498 ctx cooccurence:494
Rv3802c membrane protein 493 493 ctx cooccurence:490
Rv3035 hyp hypothetical protein 492 492 ctx cooccurence:475
Rv1275 lprC lipoprotein LprC 478 478 ctx cooccurence:459

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Surface membrane protein; HABPs inhibit mycobacterial entry (Carabali-Isajar 2018, PMID 29650461)
  • Curated from the literature crible (project 'Still unknown gene function', 2026-06-09)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_218104.1)
  • Domains: Pfam-A via hmmscan --cut_ga — none above threshold
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG 2E5CN
  • Curated reference: UniProt O53572 (TrEMBL, unreviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 36 functional partner(s); context anchor canB
  • Primary literature: Carabali-Isajar ML, Ocampo M, Rodriguez DC, Vanegas M, Curtidor H, Patarroyo MA, Patarroyo ME (2018). Towards designing a synthetic antituberculosis vaccine: The Rv3587c peptide inhibits mycobacterial entry to host cells Bioorg Med Chem 26(9):2401-2409. doi:10.1016/j.bmc.2018.03.044 PMID:29650461

Ancestral MTBC0 protein sequence

>mtbc0_003806|Rv3587c|
MLDLEPRGPLPTEIYWRRRGLALGIAVVVVGIAVAIVIAFVDSSAGAKPVSADKPASAQSHPGSPAPQAPQPAGQTEGNAAAAPPQGQNPETPTPTAAVQPPPVLKEGDDCPDSTLAVKGLTNAPQYYVGDQPKFTMVVTNIGLVSCKRDVGAAVLAAYVYSLDNKRLWSNLDCAPSNETLVKTFSPGEQVTTAVTWTGMGSAPRCPLPRPAIGPGTYNLVVQLGNLRSLPVPFILNQPPPPPGPVPAPGPAQAPPPESPAQGG