hupB Family assigned · medium auto-curated

H37Rv Rv2986c · MTBC0 mtbc0_003171 · 214 aa · 3364485–3365129 (-) · RefSeq NP_217502.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)DNA-binding protein HU
MTBC0 PGAP re-annotationDNA-binding protein HupB
Revised (this work)DNA-binding protein HupB. Pfam: Bac_DNA_binding (PF00216.27).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt P9WMK7 SwissProt · reviewed · Evidence at protein level
UniProt nameDNA-binding protein HupB
EC (curated) EC 1.16.3.1
Curated functionA nucleoid-associated protein (NAP) that probably plays a role in chromosome compactation. Binds DNA non-specifically, with greater affinity for supercoiled than linear DNA, binds well to nicked DNA, gapped and cruciform DNA. Has a preference for A:T rich DNA. Required for activation of the mtbB operon. Binds the mtbB promoter in the presence of iron, binding is seen with as little as 25 uM Fe(2+) and increases with increasing Fe(2+). RNase E and HupB jointly contribute to cellular adaptation to changing growth conditions and survival during antibiotic treatment and in the host. Plays a role i.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category L Replication, recombination and repair
Preferred namehup
eggNOG descriptionHistone-like DNA-binding protein which is capable of wrapping DNA to stabilize it, and thus to prevent its denaturation under extreme environmental conditions
Orthologous groupCOG0776
KEGG orthology K03530
Gene Ontology (117) GO:0000976, GO:0001067, GO:0001130, GO:0001216, GO:0003674, GO:0003676, GO:0003677, GO:0003684, GO:0003690, GO:0003700, GO:0005488, GO:0005575 +105 more

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS n/a
Polymorphic sites (≥ 0.1% of strains) 0 synonymous, 3 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
Bac_DNA_bindingPF00216.27 7.2e-271–89 Bacterial DNA-binding protein

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: pheT (phenylalanine--tRNA ligase subunit beta), medium confidence from genomic context alone (score 672 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv2785c rpsO 30S ribosomal protein S15 742 714 coexpression:649
Rv2412 rpsT 30S ribosomal protein S20 730 699 coexpression:674
Rv1650 pheT phenylalanine--tRNA ligase subunit beta 701 672 ctx neighborhood:544
Rv2904c rplS 50S ribosomal protein L19 594 594 coexpression:581
Rv0685 tuf elongation factor Tu 649 565 coexpression:484
Rv2987c leuD 3-isopropylmalate dehydratase small subunit 554 555 ctx neighborhood:548
Rv3648c cspA cold shock protein A 585 537
Rv2988c leuC 3-isopropylmalate dehydratase large subunit 516 516 ctx neighborhood:511
Rv0652 rplL 50S ribosomal protein L7/L12 521 494 coexpression:494
Rv0979A rpmF 50S ribosomal protein L32 555 490 coexpression:448
Rv2841c nusA transcription termination/antitermination protein NusA 489 490
Rv1307 atpH ATP synthase subunit b/delta 498 471 coexpression:470
Rv2817c cas1 CRISPR-associated endonuclease Cas1 470 471 experimental:465
Rv2442c rplU 50S ribosomal protein L21 512 463 coexpression:460
Rv3920c hyp hypothetical protein 461 461 coexpression:443

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: DNA-binding protein HU
  • MTBC0 PGAP product: DNA-binding protein HupB
  • Pfam (hmmscan --cut_ga): Bac_DNA_binding PF00216.27 (E=7e-27)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_217502.1)
  • Domains: Pfam-A via hmmscan --cut_ga — Bac_DNA_binding (PF00216.27)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG0776
  • Curated reference: UniProt P9WMK7 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 63 functional partner(s); context anchor pheT
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_003171|Rv2986c|hupB
MNKAELIDVLTQKLGSDRRQATAAVENVVDTIVRAVHKGDSVTITGFGVFEQRRRAARVARNPRTGETVKVKPTSVPAFRPGAQFKAVVSGAQRLPAEGPAVKRGVGASAAKKVAKKAPAKKATKAAKKAATKAPARKAATKAPAKKAATKAPAKKAVKATKSPAKKVTKAVKKTAVKASVRKAATKAPAKKAAAKRPATKAPAKKATARRGRK