cysA2 Resolved · high auto-curated
H37Rv Rv0815c · MTBC0 mtbc0_000864 ·
277 aa · 911552–912385 (-) ·
RefSeq NP_215330.1
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | thiosulfate sulfurtransferase CysA |
|---|---|
| MTBC0 PGAP re-annotation | sulfurtransferase |
| Revised (this work) | Sulfurtransferase. Pfam: Rhodanese (PF00581.26). |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
Curated reference (UniProt)
| UniProt |
P9WHF9
SwissProt · reviewed
· Evidence at protein level
|
|---|---|
| UniProt name | Putative thiosulfate sulfurtransferase |
| EC (curated) |
EC 2.8.1.1
|
| Curated function | May be a sulfotransferase involved in the formation of thiosulfate. |
UniProt still lists this protein as Putative thiosulfate sulfurtransferase; the revised annotation above is ahead of the current UniProt record.
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
P Inorganic ion transport and metabolism
|
|---|---|
| Preferred name | cysA3 |
| eggNOG description | sulfurtransferase |
| Orthologous group | COG2897 |
| EC number |
EC 2.8.1.1, EC 2.8.1.2
|
| KEGG orthology |
K01011
|
| KEGG pathways |
map00270, map00920, map01100, map01120, map04122
|
| Gene Ontology (13) |
GO:0005575, GO:0005618, GO:0005622, GO:0005623, GO:0005737, GO:0005829, GO:0005886, GO:0016020, GO:0030312, GO:0044424, GO:0044444, GO:0044464 +1 more
|
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS | 0.149 · strong purifying |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 2 synonymous, 1 missense, 0 nonsense, 0 frameshift |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
Rhodanese | PF00581.26 | 7.9e-19 | 149–265 | Rhodanese-like domain |
Functional interaction network (STRING v12, guilt-by-association)
Closest characterised functional partner: thiX (thioredoxin ThiX), high confidence from genomic context alone (score 761 excluding text-mining).
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv2291 sseB |
thiosulfate sulfurtransferase SseB | 936 | 928 | database:900 |
Rv3025c iscS |
cysteine desulfurase | 922 | 915 | database:900 |
Rv2392 cysH |
phosphoadenosine phosphosulfate reductase | 926 | 906 | database:900 |
Rv2391 sirA |
sulfite reductase | 914 | 906 | database:900 |
Rv3283 sseA |
thiosulfate sulfurtransferase SseA | 908 | 906 | database:900 |
Rv2294 |
cystathionine beta-lyase | 903 | 900 | database:900 |
Rv0075 |
aminotransferase | 900 | 900 | database:900 |
Rv0814c sseC2 hyp |
hypothetical protein | 923 | 850 ctx | neighborhood:789 textmining:508 |
Rv2334 cysK1 |
O-acetylserine sulfhydrylase | 834 | 825 | database:800 |
Rv1079 metB |
cystathionine gamma-synthase | 841 | 818 | database:800 |
Rv3684 |
lyase | 826 | 818 | database:800 |
Rv0391 metZ |
O-succinylhomoserine sulfhydrylase | 831 | 817 | database:800 |
Rv3118 sseC1 hyp |
hypothetical protein | 942 | 816 | coexpression:744 textmining:701 |
Rv3238c mddA |
integral membrane protein | 806 | 806 | database:800 |
Rv0816c thiX |
thioredoxin ThiX | 762 | 761 ctx | neighborhood:478 database:561 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Legacy H37Rv annotation: thiosulfate sulfurtransferase CysA
- MTBC0 PGAP product: sulfurtransferase
- Pfam (hmmscan --cut_ga): Rhodanese PF00581.26 (E=8e-19)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_215330.1)
- Domains: Pfam-A via hmmscan --cut_ga — Rhodanese (PF00581.26)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
COG2897 - Curated reference: UniProt P9WHF9 (SwissProt, reviewed; Evidence at protein level)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
38 functional partner(s); context anchor
thiX - Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>mtbc0_000864|Rv0815c|cysA2 MARCDVLVSADWAESNLHAPKVVFVEVDEDTSAYDRDHIAGAIKLDWRTDLQDPVKRDFVDAQQFSKLLSERGIANEDTVILYGGNNNWFAAYAYWYFKLYGHEKVKLLDGGRKKWELDGRPLSSDPVSRPVTSYTASPPDNTIRAFRDEVLAAINVKNLIDVRSPDEFSGKILAPAHLPQEQSQRPGHIPGAINVPWSRAANEDGTFKSDEELAKLYADAGLDNSKETIAYCRIGERSSHTWFVLRELLGHQNVKNYDGSWTEYGSLVGAPIELGS