cysA2 Resolved · high auto-curated
H37Rv Rv0815c · MTBC0 mtbc0_003313 ·
277 aa ·
3505339–3506172 MTBC0
(+) ·
RefSeq NP_215330.1
Genomic neighbourhood (genome browser)
Open in full genome browser →This gene (outlined) in its genomic context; arrows are neighbouring genes coloured by verdict. Click any gene to navigate. Pan and zoom in the full browser.
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | thiosulfate sulfurtransferase CysA |
|---|---|
| MTBC0 PGAP re-annotation | sulfurtransferase |
| Revised (this work) | Sulfurtransferase. Pfam: Rhodanese (PF00581.26). |
| Functional category (TubercuList) | intermediary metabolism and respiration |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
In the literature (TB corpus sweep) 6 publications
6 TB publications mention this gene. 6 publication(s) discuss this gene (6 in a M. tuberculosis context).
| Publication | Date |
|---|---|
| Mycobacterium tuberculosis CysA2 is a dual sulfurtransferase with activity against thiosulfate and 3-mercaptopyruvate and interacts with mammalian cells. doi:10.1038/s41598-019-53069-6 | 2019 |
| Comparative proteomic profiles reveal characteristic Mycobacterium tuberculosis proteins induced by cholesterol during dormancy conditions. doi:10.1099/mic.0.000512 | 2017 |
| CysA2: A candidate serodiagnostic marker for Mycobacterium tuberculosis infection. doi:10.1111/j.1440-1843.2010.01727.x | 2010 |
| [Effects of the Radix Ranuncoli Ternati extracts on Mycobacterium tuberculosis proteome profiling revealed by 2D electrophoresis]. | 2005 |
| Functional genomics reveals the sole sulphate transporter of the Mycobacterium tuberculosis complex and its relevance to the acquisition of sulphur in vivo. doi:10.1046/j.1365-2958.2002.02771.x | 2002 |
This layer CITES the literature and adds context; it does not change the verdict or the function stated elsewhere in this fiche. This distinguishes a gene that is dark because nobody has looked from one that is dark despite having been studied. Source: PubMed (whole): H37Rv locus tag + GENE NAME + ortholog identifiers (Mb…, MMAR_…, MSMEG_…, ML…, MAB_…), under a mycobacterial context filter; hits verified against the abstract text. Species-context counts distinguish M. tuberculosis literature from literature on other mycobacteria. phase76/phase77, 2026-07-13.
Conditional expression context (iModulons)
Member of 2 independently-modulated gene set(s):
Unc_3, Sulfur Metabolism.
iModulon membership (independently-modulated gene sets from a 647-sample RNA-seq compendium): the conditional co-expression context. Co-expression is a regulatory context, NOT a molecular function. Source: iModulonDB / modulome_mtb (Yoo 2022).
CRISPRi vulnerability
Vulnerability index 1.29 (95% CI -0.36 to 3.95). A more negative index = more vulnerable to knockdown (better drug-target quality); indicative threshold VI ≤ -6 = highly vulnerable.
Quantitative CRISPRi knockdown, graded (finer than binary Tn-seq essentiality). Source: CRISPRi vulnerability index (Bosch 2021, pebble.rockefeller.edu).
Legacy record & comparison (Mycobrowser)
| Mycobrowser function | May be a sulfotransferase involved in the formation of thiosulfate [catalytic activity: thiosulfate + cyanide = sulfite + thiocyanate]. |
|---|---|
| Mycobrowser EC |
2.8.1.1
· agrees with the atlas
|
The legacy Mycobrowser record is shown for verification. Mycobrowser is no longer maintained; its EC numbers predate recent nomenclature revisions, so a class change usually reflects re-numbering, not a conflict.
Orthologues (reciprocal best hits across mycobacteria)
| M. bovis |
Mb0838c
· 100.0% identity |
|---|---|
| M. leprae |
ML2198
· 85.2% identity |
| M. marinum |
MMAR_4868
· 87.1% identity |
| M. smegmatis |
MSMEG_5789
· 88.1% identity |
| M. orygis |
RJtmp_000861
· 100.0% identity |
| M. abscessus |
MAB_0740c
· 86.3% identity |
Reciprocal-best-hit orthologues (DIAMOND) against the Mycobrowser reference proteomes. A missing species is informative: e.g. a gene absent from M. leprae was likely lost in its reductive genome evolution. Locus tags link to Mycobrowser.
Curated reference (UniProt)
| UniProt |
P9WHF9
SwissProt · reviewed
· Evidence at protein level
|
|---|---|
| UniProt name | Putative thiosulfate sulfurtransferase |
| EC (curated) |
EC 2.8.1.1
|
| Curated function | May be a sulfotransferase involved in the formation of thiosulfate. |
UniProt still lists this protein as Putative thiosulfate sulfurtransferase; the revised annotation above is ahead of the current UniProt record.
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
P Inorganic ion transport and metabolism
|
|---|---|
| Preferred name | cysA3 |
| eggNOG description | sulfurtransferase |
| Orthologous group | COG2897 |
| EC number |
EC 2.8.1.1, EC 2.8.1.2
|
| KEGG orthology |
K01011
|
| KEGG pathways |
map00270, map00920, map01100, map01120, map04122
|
| Gene Ontology (13) |
GO:0005575, GO:0005618, GO:0005622, GO:0005623, GO:0005737, GO:0005829, GO:0005886, GO:0016020, GO:0030312, GO:0044424, GO:0044444, GO:0044464 +1 more
|
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS | 0.149 · strong purifying |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 2 synonymous, 1 missense, 0 nonsense, 0 frameshift |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Outgroup conservation (beyond the MTBC) Actinomycetia
| Genus-wide presence (~53 non-MTBC Mycobacterium) |
present in 53/53 (100%) · mean identity 88.3%
· 4/4 closest MTBAP relatives conserved across the genus (present in 53/53 non-MTBC Mycobacterium genomes, incl. distant relatives) — an ancient core gene predating the genus radiation |
|---|---|
| Phylostratum (deepest detected homolog) |
MTBC-specific → Mycobacterium → Mycobacteriaceae → Corynebacteriales → Actinomycetia → Bacteria detected in 9/13 non-Mycobacterium reference genomes (down to Actinomycetia) · mean identity 68.9% detected across the class Actinomycetia (beyond Corynebacteriales) but not outside the phylum — an Actinobacteria-level ancient gene |
Two orthogonal outgroup signals. M. canettii (the immediate outgroup) gives a deep-divergence dN/dS (a low value confirms a constrained, real gene; shown as confident only at ≥8 substitutions, else flagged low-power). Genus-wide presence/absence (tblastn vs assembled non-MTBC genomes) places the gene on the ancient-core ↔ MTBC-specific axis: a gene absent even from the closest MTBAP relatives is a candidate MTBC-specific innovation (possible host-adaptation factor, to confirm by synteny). The phylostratum extends that axis outside the genus (tblastn vs 13 reference genomes spanning Mycobacteriaceae → Corynebacteriales → Actinomycetia → outside the phylum): it is the deepest clade in which a homolog is still detected, i.e. a proxy for gene age. Read it with the null model in mind: a shallow (young) stratum can also reflect homology-detection failure for short or fast-evolving ORFs, so it is a descriptive axis, not a proof of novelty.
Essentiality (transposon mutagenesis)
| DeJesus 2017 call | GA · growth-advantage |
|---|---|
| What the call means | growth-advantage: insertions enriched |
| TA sites (Himar1) | 15 in the ORF — 0 in the essential state, 0 growth-defect, 0 non-essential, 15 growth-advantage. Saturation 1.000, mean read count 339.6. A region of the protein devoid of TA sites is invisible to this assay: nothing can be inferred about it, in either direction. |
Genome-wide Himar1 transposon essentiality in H37Rv (DeJesus 2017). An essential call (ES/ESD/GD) is strong, independent evidence that a "hypothetical" locus encodes a functional, selectively required gene — orthogonal to intra-species conservation.
Proteomics (mass spectrometry) detected
| MS detection | detected in 16 of 16 independent MS datasets |
|---|---|
| Integrated abundance | 1810.0 ppm · rank 100/3519 (97.2th percentile) |
Detection by mass spectrometry is direct, experimental evidence that the protein product exists — orthogonal to sequence conservation and to Tn-seq essentiality, and especially decisive for a "hypothetical" locus. Reproducible detection across several independent datasets (PaxDb) makes the existence claim robust; the integrated abundance places the protein in the proteome's dynamic range.
Physico-chemical properties (computed, ProtParam)
| Length | 277 aa |
|---|---|
| Molecular weight | 31.0 kDa |
| Theoretical pI | 5.14 |
| GRAVY | -0.494 (hydrophilic) |
| Aliphatic index | 81.4 |
| Aromaticity | 0.101 |
| Instability index | 37.9 (stable) |
Computed from the ancestral MTBC0 sequence with the ExPASy ProtParam method (Biopython). Descriptive biophysical context: a positive GRAVY flags a hydrophobic (often membrane) protein, a high instability index (>40) predicts a short in-vitro half-life, an extreme pI hints at compartment or binding partner.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
Rhodanese | PF00581.26 | 7.9e-19 | 149–265 | Rhodanese-like domain |
Experimental structures (Protein Data Bank) 3 solved
| PDB | Method | Resolution | Coverage |
|---|---|---|---|
3aay |
X-ray diffraction | 1.9 Å | 100% |
3hwi |
X-ray diffraction | 2.29 Å | 100% |
3aax |
X-ray diffraction | 2.5 Å | 100% |
Experimentally solved structures mapped from the UniProt accession via PDBe/SIFTS (3 total; up to 8 shown, ranked by sequence coverage then resolution). An experimental structure is direct proof of the folded product and the strongest structural evidence — superseding the predicted ESMFold/AlphaFold models below for any covered region.
Structural search (AlphaFold DB model, Foldseek vs PDB — genome-wide) pLDDT 96.4
| PDB hit | prob | TM-score | E-value | Description |
|---|---|---|---|---|
3aay-assembly2_B |
1.00 | 0.99 | 5.9e-58 sig | 3aay-assembly2_B Crystal structure of probable thiosulfate sulfurtransferase CYSA3 (RV3117) from Mycobacterium tuberculosis: orthorhombic form |
3aay-assembly1_A |
1.00 | 0.99 | 6.6e-56 sig | 3aay-assembly1_A Crystal structure of probable thiosulfate sulfurtransferase CYSA3 (RV3117) from Mycobacterium tuberculosis: orthorhombic form |
3hwi-assembly2_B |
1.00 | 0.99 | 4.0e-54 sig | 3hwi-assembly2_B Crystal structure of probable thiosulfate sulfurtransferase Cysa2 (Rhodanese-like protein) from Mycobacterium tuberculosis |
3aax-assembly2_B |
1.00 | 0.98 | 3.3e-54 sig | 3aax-assembly2_B Crystal structure of probable thiosulfate sulfurtransferase cysa3 (RV3117) from Mycobacterium tuberculosis: monoclinic FORM |
3aax-assembly1_A |
1.00 | 0.99 | 6.5e-54 sig | 3aax-assembly1_A Crystal structure of probable thiosulfate sulfurtransferase cysa3 (RV3117) from Mycobacterium tuberculosis: monoclinic FORM |
Foldseek search of the AlphaFold DB model (mean pLDDT 96.4, gated at 70) against the PDB — a genome-wide extension of the ESMFold dark-gene search that also covers proteins beyond the single-sequence length limit. Confident structural neighbours (E < 0.01) shown.
Genomic context (neighbours & predicted operon) operon of 2
| Upstream (5' on genome) | Rv0814c (- strand, 1 bp gap) |
|---|---|
| Downstream (3' on genome) | thiX (- strand, 292 bp gap) |
| Predicted operon |
Rv0814c · cysA2
|
Neighbours from the H37Rv annotation (- strand). The operon is predicted by co-directional intergenic distance (same strand, gaps ≤50 bp) — a transcription-unit hypothesis, not a mapped TSS. For a "hypothetical", co-transcription with a characterised operon is a concrete functional lead (complements the STRING neighborhood channel below).
Functional interaction network (STRING v12, guilt-by-association)
Explore full network →Node colour = verdict, dashed = hypothetical; edge colour = evidence (green experimental, orange genomic-context, grey co-expression), width ∝ score. Click a partner to open its page; "Explore full network" to walk the graph.
Closest characterised functional partner: thiX (thioredoxin ThiX), high confidence from genomic context alone (score 761 excluding text-mining).
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv2291 sseB exp |
thiosulfate sulfurtransferase SseB | 936 | 928 | database:900 |
Rv3025c iscS exp |
cysteine desulfurase | 922 | 915 | database:900 |
Rv2392 cysH exp |
phosphoadenosine phosphosulfate reductase | 926 | 906 | database:900 |
Rv2391 sirA exp |
sulfite reductase | 914 | 906 | database:900 |
Rv3283 sseA exp |
thiosulfate sulfurtransferase SseA | 908 | 906 | database:900 |
Rv2294 exp |
cystathionine beta-lyase | 903 | 900 | database:900 |
Rv0075 exp |
aminotransferase | 900 | 900 | database:900 |
Rv0814c sseC2 hyp |
hypothetical protein | 923 | 850 ctx | neighborhood:789 textmining:508 |
Rv2334 cysK1 exp |
O-acetylserine sulfhydrylase | 834 | 825 | database:800 |
Rv1079 metB exp |
cystathionine gamma-synthase | 841 | 818 | database:800 |
Rv3684 exp |
lyase | 826 | 818 | database:800 |
Rv0391 metZ exp |
O-succinylhomoserine sulfhydrylase | 831 | 817 | database:800 |
Rv3118 sseC1 hyp |
hypothetical protein | 942 | 816 | coexpression:744 textmining:701 |
Rv3238c mddA exp |
integral membrane protein | 806 | 806 | database:800 |
Rv0816c thiX exp |
thioredoxin ThiX | 762 | 761 ctx | neighborhood:478 database:561 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The exp badge marks an experimentally-supported partner (measured interaction, experimental/database channel ≥400) as opposed to a purely predicted one — but note that the M. tuberculosis experimental interactome is dominated by a noisy bacterial-two-hybrid screen, so a strong measured link that contradicts the operon/localisation context is likely a false positive. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Legacy H37Rv annotation: thiosulfate sulfurtransferase CysA
- MTBC0 PGAP product: sulfurtransferase
- Pfam (hmmscan --cut_ga): Rhodanese PF00581.26 (E=8e-19)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_215330.1)
- Domains: Pfam-A via hmmscan --cut_ga — Rhodanese (PF00581.26)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
COG2897 - Curated reference: UniProt P9WHF9 (SwissProt, reviewed; Evidence at protein level)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Genome-wide structure: AlphaFold DB model (Jumper et al. 2021, doi:10.1038/s41586-021-03819-2; Varadi et al. 2024, doi:10.1093/nar/gkad1011) searched vs PDB with Foldseek (mean pLDDT 96.4)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
38 functional partner(s); context anchor
thiX - Essentiality: genome-wide transposon mutagenesis in H37Rv — DeJesus et al. 2017 (mBio, doi:10.1128/mBio.02133-16, CC BY)
- Proteomics: integrated mass-spectrometry abundance from PaxDb 5.0 (Huang et al. 2023, doi:10.1016/j.mcpro.2023.100640), taxon 83332 — weighted average of 16 datasets, incl. Schubert et al. 2013 (doi:10.1016/j.chom.2013.04.008) and Albrethsen et al. 2013 (doi:10.1074/mcp.M112.018846)
- Functional category: TubercuList scheme (Cole et al. 1998, doi:10.1038/31159), via Mycobrowser (Kapopoulou et al. 2011, doi:10.1016/j.tube.2010.09.006)
- Orthologues: reciprocal best hits (DIAMOND, Buchfink et al. 2021, doi:10.1038/s41592-021-01101-x) against Mycobrowser release 5 reference proteomes
- Experimental structures: PDBe/SIFTS UniProt→PDB mapping (Dana et al. 2019, doi:10.1093/nar/gky1114)
- Genomic context / operon: H37Rv annotation; operon predicted by co-directional intergenic distance (Salgado et al. 2000, doi:10.1073/pnas.030539397)
- Physico-chemical properties: ExPASy ProtParam method via Biopython (Gasteiger et al. 2005), computed from the MTBC0 sequence
- Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>mtbc0_003313|Rv0815c|cysA2 MARCDVLVSADWAESNLHAPKVVFVEVDEDTSAYDRDHIAGAIKLDWRTDLQDPVKRDFVDAQQFSKLLSERGIANEDTVILYGGNNNWFAAYAYWYFKLYGHEKVKLLDGGRKKWELDGRPLSSDPVSRPVTSYTASPPDNTIRAFRDEVLAAINVKNLIDVRSPDEFSGKILAPAHLPQEQSQRPGHIPGAINVPWSRAANEDGTFKSDEELAKLYADAGLDNSKETIAYCRIGERSSHTWFVLRELLGHQNVKNYDGSWTEYGSLVGAPIELGS
Spot an error? Suggest an improvement
Found a mistake, a missing reference, or have a better functional hypothesis for cysA2? Email the maintainer — the message is pre-filled with this gene's details.