cysA2 Resolved · high auto-curated

H37Rv Rv0815c · MTBC0 mtbc0_000864 · 277 aa · 911552–912385 (-) · RefSeq NP_215330.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)thiosulfate sulfurtransferase CysA
MTBC0 PGAP re-annotationsulfurtransferase
Revised (this work)Sulfurtransferase. Pfam: Rhodanese (PF00581.26).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt P9WHF9 SwissProt · reviewed · Evidence at protein level
UniProt namePutative thiosulfate sulfurtransferase
EC (curated) EC 2.8.1.1
Curated functionMay be a sulfotransferase involved in the formation of thiosulfate.

UniProt still lists this protein as Putative thiosulfate sulfurtransferase; the revised annotation above is ahead of the current UniProt record.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category P Inorganic ion transport and metabolism
Preferred namecysA3
eggNOG descriptionsulfurtransferase
Orthologous groupCOG2897
EC number EC 2.8.1.1, EC 2.8.1.2
KEGG orthology K01011
KEGG pathways map00270, map00920, map01100, map01120, map04122
Gene Ontology (13) GO:0005575, GO:0005618, GO:0005622, GO:0005623, GO:0005737, GO:0005829, GO:0005886, GO:0016020, GO:0030312, GO:0044424, GO:0044444, GO:0044464 +1 more

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.149 · strong purifying
Polymorphic sites (≥ 0.1% of strains) 2 synonymous, 1 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
RhodanesePF00581.26 7.9e-19149–265 Rhodanese-like domain

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: thiX (thioredoxin ThiX), high confidence from genomic context alone (score 761 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv2291 sseB thiosulfate sulfurtransferase SseB 936 928 database:900
Rv3025c iscS cysteine desulfurase 922 915 database:900
Rv2392 cysH phosphoadenosine phosphosulfate reductase 926 906 database:900
Rv2391 sirA sulfite reductase 914 906 database:900
Rv3283 sseA thiosulfate sulfurtransferase SseA 908 906 database:900
Rv2294 cystathionine beta-lyase 903 900 database:900
Rv0075 aminotransferase 900 900 database:900
Rv0814c sseC2 hyp hypothetical protein 923 850 ctx neighborhood:789 textmining:508
Rv2334 cysK1 O-acetylserine sulfhydrylase 834 825 database:800
Rv1079 metB cystathionine gamma-synthase 841 818 database:800
Rv3684 lyase 826 818 database:800
Rv0391 metZ O-succinylhomoserine sulfhydrylase 831 817 database:800
Rv3118 sseC1 hyp hypothetical protein 942 816 coexpression:744 textmining:701
Rv3238c mddA integral membrane protein 806 806 database:800
Rv0816c thiX thioredoxin ThiX 762 761 ctx neighborhood:478 database:561

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: thiosulfate sulfurtransferase CysA
  • MTBC0 PGAP product: sulfurtransferase
  • Pfam (hmmscan --cut_ga): Rhodanese PF00581.26 (E=8e-19)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_215330.1)
  • Domains: Pfam-A via hmmscan --cut_ga — Rhodanese (PF00581.26)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG2897
  • Curated reference: UniProt P9WHF9 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 38 functional partner(s); context anchor thiX
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_000864|Rv0815c|cysA2
MARCDVLVSADWAESNLHAPKVVFVEVDEDTSAYDRDHIAGAIKLDWRTDLQDPVKRDFVDAQQFSKLLSERGIANEDTVILYGGNNNWFAAYAYWYFKLYGHEKVKLLDGGRKKWELDGRPLSSDPVSRPVTSYTASPPDNTIRAFRDEVLAAINVKNLIDVRSPDEFSGKILAPAHLPQEQSQRPGHIPGAINVPWSRAANEDGTFKSDEELAKLYADAGLDNSKETIAYCRIGERSSHTWFVLRELLGHQNVKNYDGSWTEYGSLVGAPIELGS