Rv2365c Resolved · high auto-curated

H37Rv Rv2365c · MTBC0 mtbc0_002517 · 113 aa · 2670940–2671281 (-) · RefSeq NP_216881.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)hypothetical protein
MTBC0 PGAP re-annotationcytidine deaminase
Revised (this work)Cytidine deaminase. Pfam: CDL (PF26947.1).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt O05833 TrEMBL · unreviewed · Predicted
UniProt nameCytidine deaminase

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category F Nucleotide transport and metabolism
eggNOG descriptioncytidine deaminase
Orthologous groupCOG0295

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
CDLPF26947.1 1.9e-3512–110 Cytidine deaminase-like

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: Rv2366c (transmembrane protein), high confidence from genomic context alone (score 983 excluding text-mining). This association is the citable seed of a function hypothesis for this hypothetical protein.

PartnerProductScoreNo text-miningChannels (≥400)
Rv2366c transmembrane protein 982 983 ctx neighborhood:882 coexpression:860
Rv2364c era GTPase Era 980 980 ctx neighborhood:791 coexpression:908
Rv2367c ybeY endoribonuclease 977 976 ctx neighborhood:882 coexpression:807
Rv2368c phoH1 phosphate starvation-inducible protein PhoH 944 944 ctx neighborhood:881 coexpression:548
Rv2370c hyp hypothetical protein 800 799 ctx neighborhood:773
Rv1334 mec [CysO 783 783 ctx cooccurence:771
Rv2369c hyp hypothetical protein 775 774 ctx neighborhood:773
Rv3608c folP1 dihydropteroate synthase 753 754 coexpression:746
Rv2357c glyS glycine--tRNA ligase 649 649 coexpression:629
Rv3118 sseC1 hyp hypothetical protein 638 638 ctx cooccurence:636
Rv0814c sseC2 hyp hypothetical protein 636 637 ctx cooccurence:636
Rv1270c lprA lipoprotein LprA 632 632 ctx cooccurence:632
Rv1336 cysM O-phosphoserine sulfhydrylase 614 615 ctx cooccurence:441
Rv0343 iniC iIsoniazid inductible protein IniC 609 606 coexpression:520
Rv1335 cysO sulfur carrier protein CysO 586 587 ctx cooccurence:574

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: hypothetical protein
  • MTBC0 PGAP product: cytidine deaminase
  • Pfam (hmmscan --cut_ga): CDL PF26947.1 (E=2e-35)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_216881.1)
  • Domains: Pfam-A via hmmscan --cut_ga — CDL (PF26947.1)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG0295
  • Curated reference: UniProt O05833 (TrEMBL, unreviewed; Predicted)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 31 functional partner(s); context anchor Rv2366c
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_002517|Rv2365c|
MMRRPITLAEQLDAEDAKLVVLARAAMARAEAGAGAAVRDVDGRTYAAAPVALSALELTGLQAAVAAAVSSGATGLQAAVLVAGSVDDPGIAAVRELAPTAAIIVTDRAGNPL