Rv2365c Resolved · high auto-curated
H37Rv Rv2365c · MTBC0 mtbc0_002517 ·
113 aa · 2670940–2671281 (-) ·
RefSeq NP_216881.1
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | hypothetical protein |
|---|---|
| MTBC0 PGAP re-annotation | cytidine deaminase |
| Revised (this work) | Cytidine deaminase. Pfam: CDL (PF26947.1). |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
Curated reference (UniProt)
| UniProt |
O05833
TrEMBL · unreviewed
· Predicted
|
|---|---|
| UniProt name | Cytidine deaminase |
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
F Nucleotide transport and metabolism
|
|---|---|
| eggNOG description | cytidine deaminase |
| Orthologous group | COG0295 |
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
CDL | PF26947.1 | 1.9e-35 | 12–110 | Cytidine deaminase-like |
Functional interaction network (STRING v12, guilt-by-association)
Closest characterised functional partner: Rv2366c (transmembrane protein), high confidence from genomic context alone (score 983 excluding text-mining). This association is the citable seed of a function hypothesis for this hypothetical protein.
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv2366c |
transmembrane protein | 982 | 983 ctx | neighborhood:882 coexpression:860 |
Rv2364c era |
GTPase Era | 980 | 980 ctx | neighborhood:791 coexpression:908 |
Rv2367c ybeY |
endoribonuclease | 977 | 976 ctx | neighborhood:882 coexpression:807 |
Rv2368c phoH1 |
phosphate starvation-inducible protein PhoH | 944 | 944 ctx | neighborhood:881 coexpression:548 |
Rv2370c hyp |
hypothetical protein | 800 | 799 ctx | neighborhood:773 |
Rv1334 mec |
[CysO | 783 | 783 ctx | cooccurence:771 |
Rv2369c hyp |
hypothetical protein | 775 | 774 ctx | neighborhood:773 |
Rv3608c folP1 |
dihydropteroate synthase | 753 | 754 | coexpression:746 |
Rv2357c glyS |
glycine--tRNA ligase | 649 | 649 | coexpression:629 |
Rv3118 sseC1 hyp |
hypothetical protein | 638 | 638 ctx | cooccurence:636 |
Rv0814c sseC2 hyp |
hypothetical protein | 636 | 637 ctx | cooccurence:636 |
Rv1270c lprA |
lipoprotein LprA | 632 | 632 ctx | cooccurence:632 |
Rv1336 cysM |
O-phosphoserine sulfhydrylase | 614 | 615 ctx | cooccurence:441 |
Rv0343 iniC |
iIsoniazid inductible protein IniC | 609 | 606 | coexpression:520 |
Rv1335 cysO |
sulfur carrier protein CysO | 586 | 587 ctx | cooccurence:574 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Legacy H37Rv annotation: hypothetical protein
- MTBC0 PGAP product: cytidine deaminase
- Pfam (hmmscan --cut_ga): CDL PF26947.1 (E=2e-35)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_216881.1)
- Domains: Pfam-A via hmmscan --cut_ga — CDL (PF26947.1)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
COG0295 - Curated reference: UniProt O05833 (TrEMBL, unreviewed; Predicted)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
31 functional partner(s); context anchor
Rv2366c - Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>mtbc0_002517|Rv2365c| MMRRPITLAEQLDAEDAKLVVLARAAMARAEAGAGAAVRDVDGRTYAAAPVALSALELTGLQAAVAAAVSSGATGLQAAVLVAGSVDDPGIAAVRELAPTAAIIVTDRAGNPL