smpB Family assigned · medium auto-curated

H37Rv Rv3100c · MTBC0 mtbc0_003296 · 160 aa · 3490665–3491147 (-) · RefSeq NP_217616.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)SsrA-binding protein
MTBC0 PGAP re-annotationSsrA-binding protein SmpB
Revised (this work)SsrA-binding protein SmpB. Pfam: SmpB (PF01668.24).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt P9WGD3 SwissProt · reviewed · Evidence at protein level
UniProt nameSsrA-binding protein
Curated functionRequired for rescue of stalled ribosomes mediated by trans-translation. Binds to transfer-messenger RNA (tmRNA), required for stable association of tmRNA with ribosomes. tmRNA and SmpB together mimic tRNA shape, replacing the anticodon stem-loop with SmpB. tmRNA is encoded by the ssrA gene; the 2 termini fold to resemble tRNA(Ala) and it encodes a 'tag peptide', a short internal open reading frame. During trans-translation Ala-aminoacylated tmRNA acts like a tRNA, entering the A-site of stalled ribosomes, displacing the stalled mRNA. The ribosome then switches to translate the ORF on the tmRNA.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category J Translation, ribosomal structure and biogenesis
Preferred namesmpB
eggNOG descriptionRequired for rescue of stalled ribosomes mediated by trans-translation. Binds to transfer-messenger RNA (tmRNA), required for stable association of tmRNA with ribosomes. tmRNA and SmpB together mimic tRNA shape, replacing the anticodon stem-loop with SmpB. tmRNA is encoded by the ssrA gene
Orthologous groupCOG0691
KEGG orthology K03664
Gene Ontology (8) GO:0005575, GO:0005622, GO:0005623, GO:0005737, GO:0005829, GO:0044424, GO:0044444, GO:0044464

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.165 · strong purifying
Polymorphic sites (≥ 0.1% of strains) 2 synonymous, 1 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
SmpBPF01668.24 2.6e-5912–152 SmpB protein

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: rpsO (30S ribosomal protein S15), high confidence from genomic context alone (score 956 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv2785c rpsO 30S ribosomal protein S15 961 956 ctx cooccurence:506 experimental:911
Rv3458c rpsD 30S ribosomal protein S4 958 956 experimental:911
Rv2904c rplS 50S ribosomal protein L19 981 954 ctx cooccurence:436 experimental:911 textmining:607
Rv0723 rplO 50S ribosomal protein L15 950 948 experimental:911
Rv0718 rpsH 30S ribosomal protein S8 953 944 experimental:911
Rv0683 rpsG 30S ribosomal protein S7 947 941 experimental:911
Rv3456c rplQ 50S ribosomal protein L17 944 937 experimental:911
Rv1643 rplT 50S ribosomal protein L20 972 935 experimental:911 textmining:591
Rv2890c rpsB 30S ribosomal protein S2 971 934 experimental:911 textmining:590
Rv0701 rplC 50S ribosomal protein L3 970 933 experimental:911 textmining:577
Rv0707 rpsC 30S ribosomal protein S3 970 931 experimental:911 textmining:591
Rv2442c rplU 50S ribosomal protein L21 933 930 experimental:911
Rv0720 rplR 50S ribosomal protein L18 933 930 experimental:911
Rv3443c rplM 50S ribosomal protein L13 969 929 experimental:912 textmining:589
Rv0682 rpsL 30S ribosomal protein S12 938 929 experimental:911

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: SsrA-binding protein
  • MTBC0 PGAP product: SsrA-binding protein SmpB
  • Pfam (hmmscan --cut_ga): SmpB PF01668.24 (E=3e-59)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_217616.1)
  • Domains: Pfam-A via hmmscan --cut_ga — SmpB (PF01668.24)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG0691
  • Curated reference: UniProt P9WGD3 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 118 functional partner(s); context anchor rpsO
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_003296|Rv3100c|smpB
MSKSSRGGRQIVASNRKARHNYSIIEVFEAGVALQGTEVKSLREGQASLADSFATIDDGEVWLRNAHIPEYRHGSWTNHEPRRNRKLLLHRRQIDTLVGKIREGNFALVPLSLYFAEGKVKVELALARGKQARDKRQDMARRDAQREVLRELGRRAKGMT