Rv3093c Resolved · high auto-curated

H37Rv Rv3093c · MTBC0 mtbc0_003287 · 334 aa · 3483124–3484128 (-) · RefSeq NP_217609.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)oxidoreductase
MTBC0 PGAP re-annotationLLM class F420-dependent oxidoreductase
Revised (this work)LLM class F420-dependent oxidoreductase. Pfam: Bac_luciferase (PF00296.27).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt O05772 TrEMBL · unreviewed · Evidence at protein level
UniProt nameHypothetical oxidoreductase

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category C Energy production and conversion
eggNOG descriptionLuciferase-like monooxygenase
Orthologous groupCOG2141

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.588 · relaxed/neutral
Polymorphic sites (≥ 0.1% of strains) 2 synonymous, 3 missense, 0 nonsense, 4 frameshift
Disruption 4 distinct premature-stop/frameshift site(s); most common in 9.55% of strains (13866) · convergent

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
Bac_luciferasePF00296.27 2.2e-4017–297 Luciferase-like monooxygenase

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: Rv3095 (HTH-type transcriptional regulator), high confidence from genomic context alone (score 899 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv3094c hyp hypothetical protein 983 983 ctx neighborhood:881 coexpression:865
Rv3095 HTH-type transcriptional regulator 898 899 ctx neighborhood:636 coexpression:733
Rv3262 fbiB coenzyme F420:L-glutamate ligase 781 767 ctx cooccurence:737
Rv3261 fbiA 2-phospho-L-lactate transferase 760 747 ctx cooccurence:739
Rv2951c phthiodiolone/phenolphthiodiolone dimycocerosates ketoreductase 742 743 ctx cooccurence:742
Rv2893 oxidoreductase 735 735 ctx cooccurence:735
Rv2161c hyp hypothetical protein 730 730 ctx cooccurence:730
Rv3092c integral membrane protein 723 723 ctx neighborhood:707
Rv1261c hyp hypothetical protein 718 719 ctx cooccurence:718
Rv3547 ddn deazaflavin-dependent nitroreductase 730 713 ctx cooccurence:713
Rv3072c hyp hypothetical protein 705 705 ctx cooccurence:703
Rv0132c fgd2 F420-dependent glucose-6-phosphate dehydrogenase 705 705 ctx cooccurence:705
Rv1855c oxidoreductase 700 701 ctx cooccurence:700
Rv3178 nitroreductase 702 684 ctx cooccurence:684
Rv1360 oxidoreductase 662 662 ctx cooccurence:660

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: oxidoreductase
  • MTBC0 PGAP product: LLM class F420-dependent oxidoreductase
  • Pfam (hmmscan --cut_ga): Bac_luciferase PF00296.27 (E=2e-40)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_217609.1)
  • Domains: Pfam-A via hmmscan --cut_ga — Bac_luciferase (PF00296.27)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG2141
  • Curated reference: UniProt O05772 (TrEMBL, unreviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 24 functional partner(s); context anchor Rv3095
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_003287|Rv3093c|
MTDIEVALPFWLDRPDHEATDVALAAADTGFAALWIGEMATYDAFALATSIGLRTPNMTLKVGPLAVGVRGPVGLALGVSSVASLTGCRVDLALGASSPAIVAGWHGRPWAHHVPVMRETIECLRSIFTGARVEYSGRHVNSRGFRLRGAAPDTRIALGAFGPGMIRLAAQHADEVVLNLASPFRVGRVRAAIDSAAAAAGRAAPRLTVWVPVAVNPGAAAHSQLAAQLAVYLAPPGYGEMFSALGFDGLVRSARSRATRRELAVAVPSELLDRVCALGSPDRVAARLRAYADAGADCVAVVPATAEDPGGRVALRALRPGGLYGTAGDNDGRR