Rv3095 Family assigned · medium auto-curated

H37Rv Rv3095 · MTBC0 mtbc0_003289 · 158 aa · 3485337–3485813 MTBC0 (+) · RefSeq NP_217611.1

Genomic neighbourhood (genome browser)

Open in full genome browser →
+ strand − strand adhD (Rv3086) — requalified: NDMA-dependent alcohol dehydrogenase Rv3087 (Rv3087) — family_assigned: wax ester/triacylglycerol synthase family O-acyltransferase Rv3087 tgs4 (Rv3088) — family_assigned: wax ester/triacylglycerol synthase family O-acyltransferase tgs4 fadD13 (Rv3089) — requalified: long-chain-fatty-acid--CoA ligase FadD13 fadD13 Rv3090 (Rv3090) — family_assigned: SPFH domain-containing protein Rv3090 Rv3091 (Rv3091) — family_assigned: patatin-like phospholipase family protein Rv3091 Rv3092c (Rv3092c) — family_assigned: DUF808 domain-containing protein Rv3092c Rv3093c (Rv3093c) — requalified: LLM class F420-dependent oxidoreductase Rv3093c Rv3094c (Rv3094c) — family_assigned: acyl-CoA dehydrogenase family protein Rv3094c Rv3095 (Rv3095) — family_assigned: helix-turn-helix domain-containing protein Rv3096 (Rv3096) — requalified: 1%2C4-beta-xylanase Rv3096 Rv3098c (Rv3098c) — dark: hypothetical protein Rv3099c (Rv3099c) — family_assigned: maleylpyruvate isomerase family mycothiol-dependent enzyme Rv3099c smpB (Rv3100c) — family_assigned: SsrA-binding protein SmpB ftsX (Rv3101c) — requalified: permease-like cell division protein FtsX ftsX ftsE (Rv3102c) — family_assigned: cell division ATP-binding protein FtsE Rv3103c (Rv3103c) — dark: hypothetical protein Rv3104c (Rv3104c) — family_assigned: mechanosensitive ion channel family protein Rv3104c fprA (Rv3106) — requalified: ferredoxin--NADP(+) reductase FprA fprA agpS (Rv3107c) — requalified: FAD-binding oxidoreductase agpS 3 476 kb 3 480 kb 3 484 kb 3 488 kb 3 492 kb 3 496 kb

This gene (outlined) in its genomic context; arrows are neighbouring genes coloured by verdict. Click any gene to navigate. Pan and zoom in the full browser.

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)HTH-type transcriptional regulator
MTBC0 PGAP re-annotationhelix-turn-helix domain-containing protein
Revised (this work)Helix-turn-helix domain-containing protein. Pfam: HxlR (PF01638.24), HTH_5 (PF01022.27).
Functional category (TubercuList)regulatory proteins

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

In the literature (TB corpus sweep) 2 publications

2 TB publications mention this gene. 2 publication(s) discuss this gene (2 in a M. tuberculosis context).

PublicationDate
Omics analysis of Mycobacterium tuberculosis isolates uncovers Rv3094c, an ethionamide metabolism-associated gene. doi:10.1038/s42003-023-04433-w 2023
[MxyR of Mycobacterium tuberculosis Responds to Xylan; an Unusual Ligand for a MarR Family Transcriptional Regulator]. doi:10.31857/S0026898422010074 2022

This layer CITES the literature and adds context; it does not change the verdict or the function stated elsewhere in this fiche. This distinguishes a gene that is dark because nobody has looked from one that is dark despite having been studied. Source: PubMed (whole): H37Rv locus tag + GENE NAME + ortholog identifiers (Mb…, MMAR_…, MSMEG_…, ML…, MAB_…), under a mycobacterial context filter; hits verified against the abstract text. Species-context counts distinguish M. tuberculosis literature from literature on other mycobacteria. phase76/phase77, 2026-07-13.

Conditional expression context (iModulons)

Member of 1 independently-modulated gene set(s): Rv3095 (Rv3095).

iModulon membership (independently-modulated gene sets from a 647-sample RNA-seq compendium): the conditional co-expression context. Co-expression is a regulatory context, NOT a molecular function. Source: iModulonDB / modulome_mtb (Yoo 2022).

CRISPRi vulnerability

Vulnerability index 0.73 (95% CI -1.30 to 3.85). A more negative index = more vulnerable to knockdown (better drug-target quality); indicative threshold VI ≤ -6 = highly vulnerable.

Quantitative CRISPRi knockdown, graded (finer than binary Tn-seq essentiality). Source: CRISPRi vulnerability index (Bosch 2021, pebble.rockefeller.edu).

Legacy record & comparison (Mycobrowser)

Mycobrowser functionUnknown. Could be involved in regulatory mechanism.

The legacy Mycobrowser record is shown for verification. Mycobrowser is no longer maintained; its EC numbers predate recent nomenclature revisions, so a class change usually reflects re-numbering, not a conflict.

Orthologues (reciprocal best hits across mycobacteria)

M. bovis Mb3122 · 100.0% identity
M. marinum MMAR_1555 · 80.9% identity
M. smegmatis MSMEG_6580 · 41.9% identity
M. orygis RJtmp_003199 · 100.0% identity
M. abscessus MAB_3456 · 40.9% identity

Reciprocal-best-hit orthologues (DIAMOND) against the Mycobrowser reference proteomes. A missing species is informative: e.g. a gene absent from M. leprae was likely lost in its reductive genome evolution. Locus tags link to Mycobrowser.

Curated reference (UniProt)

UniProt P9WMG3 SwissProt · reviewed · Evidence at protein level
UniProt nameUncharacterized HTH-type transcriptional regulator Rv3095

UniProt still lists this protein as Uncharacterized HTH-type transcriptional regulator Rv3095; the revised annotation above is ahead of the current UniProt record.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category K Transcription
eggNOG descriptionHxlR-like helix-turn-helix
Orthologous groupCOG1733

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.362 · purifying
Polymorphic sites (≥ 0.1% of strains) 1 synonymous, 1 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Outgroup conservation (beyond the MTBC) Bacteria

Genus-wide presence (~53 non-MTBC Mycobacterium) present in 51/53 (96%) · mean identity 55.0% · 4/4 closest MTBAP relatives
conserved across the genus (present in 51/53 non-MTBC Mycobacterium genomes, incl. distant relatives) — an ancient core gene predating the genus radiation
Phylostratum (deepest detected homolog) MTBC-specific Mycobacterium Mycobacteriaceae Corynebacteriales Actinomycetia Bacteria
detected in 8/13 non-Mycobacterium reference genomes (down to Bacteria) · mean identity 40.7%
detected down to outside the phylum (Proteobacteria/Firmicutes controls) — a universally conserved, ancient bacterial gene

Two orthogonal outgroup signals. M. canettii (the immediate outgroup) gives a deep-divergence dN/dS (a low value confirms a constrained, real gene; shown as confident only at ≥8 substitutions, else flagged low-power). Genus-wide presence/absence (tblastn vs assembled non-MTBC genomes) places the gene on the ancient-core ↔ MTBC-specific axis: a gene absent even from the closest MTBAP relatives is a candidate MTBC-specific innovation (possible host-adaptation factor, to confirm by synteny). The phylostratum extends that axis outside the genus (tblastn vs 13 reference genomes spanning Mycobacteriaceae → Corynebacteriales → Actinomycetia → outside the phylum): it is the deepest clade in which a homolog is still detected, i.e. a proxy for gene age. Read it with the null model in mind: a shallow (young) stratum can also reflect homology-detection failure for short or fast-evolving ORFs, so it is a descriptive axis, not a proof of novelty.

Essentiality (transposon mutagenesis)

DeJesus 2017 callNE · non-essential
What the call meansnon-essential
TA sites (Himar1) 9 in the ORF — 0 in the essential state, 0 growth-defect, 9 non-essential, 0 growth-advantage. Saturation 1.000, mean read count 185.111111111. A region of the protein devoid of TA sites is invisible to this assay: nothing can be inferred about it, in either direction.
CaveatRead with some caution: only 9 TA (Himar1) sites in the whole ORF (atlas median 13). The DeJesus 2017 call rests on fewer independent observations than for a longer gene. If this gene overlaps a neighbour (see Genomic-neighbour overlap section below), some of these 9 sites may fall inside the neighbour's ORF rather than its own, leaving even fewer truly informative sites than the raw count suggests. (P20.3)

Genome-wide Himar1 transposon essentiality in H37Rv (DeJesus 2017). An essential call (ES/ESD/GD) is strong, independent evidence that a "hypothetical" locus encodes a functional, selectively required gene — orthogonal to intra-species conservation.

Proteomics (mass spectrometry) detected

MS detectiondetected in 7 of 16 independent MS datasets
Integrated abundance17.9 ppm · rank 2398/3519 (31.9th percentile)

Detection by mass spectrometry is direct, experimental evidence that the protein product exists — orthogonal to sequence conservation and to Tn-seq essentiality, and especially decisive for a "hypothetical" locus. Reproducible detection across several independent datasets (PaxDb) makes the existence claim robust; the integrated abundance places the protein in the proteome's dynamic range.

Physico-chemical properties (computed, ProtParam)

Length158 aa
Molecular weight17.8 kDa
Theoretical pI7.02
GRAVY-0.305 (hydrophilic)
Aliphatic index87.0
Aromaticity0.076
Instability index36.5 (stable)

Computed from the ancestral MTBC0 sequence with the ExPASy ProtParam method (Biopython). Descriptive biophysical context: a positive GRAVY flags a hydrophobic (often membrane) protein, a high instability index (>40) predicts a short in-vitro half-life, an extreme pI hints at compartment or binding partner.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
HxlRPF01638.24 5.1e-2821–108 HxlR-like helix-turn-helix
HTH_5PF01022.27 9.5e-0529–67 Bacterial regulatory protein, arsR family

Structural search (AlphaFold DB model, Foldseek vs PDB — genome-wide) pLDDT 89.9

PDB hitprobTM-scoreE-valueDescription
2f2e-assembly1_A 1.00 0.85 1.0e-09 sig 2f2e-assembly1_A Crystal Structure of PA1607, a Putative Transcription Factor
4gcv-assembly6_K 1.00 0.69 2.0e-09 sig 4gcv-assembly6_K Structure of a Putative transcription factor (PA1374)from Pseudomonas aeruginosa
4gcv-assembly1_A 1.00 0.67 1.8e-08 sig 4gcv-assembly1_A Structure of a Putative transcription factor (PA1374)from Pseudomonas aeruginosa
7kd3-assembly1_A 1.00 0.91 6.1e-06 sig 7kd3-assembly1_A Structure of an HxlR/DUF24 family transcription regulator, CdTR_3200 from hypervirulent Clostridioides difficile R20291
2hzt-assembly1_B 1.00 0.90 8.4e-06 sig 2hzt-assembly1_B Crystal Structure of a putative HTH-type transcriptional regulator ytcD

Foldseek search of the AlphaFold DB model (mean pLDDT 89.9, gated at 70) against the PDB — a genome-wide extension of the ESMFold dark-gene search that also covers proteins beyond the single-sequence length limit. Confident structural neighbours (E < 0.01) shown.

Genomic context (neighbours & predicted operon)

Upstream (5' on genome)Rv3094c (- strand, 81 bp gap)
Downstream (3' on genome)Rv3096 (+ strand, 97 bp gap)

Neighbours from the H37Rv annotation (+ strand). The operon is predicted by co-directional intergenic distance (same strand, gaps ≤50 bp) — a transcription-unit hypothesis, not a mapped TSS. For a "hypothetical", co-transcription with a characterised operon is a concrete functional lead (complements the STRING neighborhood channel below).

Transcriptional regulation (signed TRN: ChIP-seq + TFOE) transcription factor

Regulated by (3 TF) Rv0494 (represses) · Rv1353c (represses) · Rv3095 (activates)
Regulonthis transcription factor regulates 3 target gene(s)

Regulatory edges from the ISB signed transcriptional regulatory network (TF ChIP-seq binding, Minch 2015 + TF-overexpression response, Rustad 2014). An edge is regulatory evidence (binding and/or expression change), not necessarily direct. For a "hypothetical", membership in a known regulon (e.g. DosR dormancy, PhoP virulence) is a strong physiological-context lead.

Functional interaction network (STRING v12, guilt-by-association)

Explore full network →

Node colour = verdict, dashed = hypothetical; edge colour = evidence (green experimental, orange genomic-context, grey co-expression), width ∝ score. Click a partner to open its page; "Explore full network" to walk the graph.

Closest characterised functional partner: Rv3093c (oxidoreductase), high confidence from genomic context alone (score 899 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv3093c oxidoreductase 898 899 ctx neighborhood:636 coexpression:733
Rv3094c hyp hypothetical protein 984 886 ctx neighborhood:783 coexpression:494 textmining:870
Rv3092c integral membrane protein 877 877 ctx neighborhood:507 coexpression:761
Rv3096 hyp hypothetical protein 670 671 ctx neighborhood:652
Rv2405 hyp hypothetical protein 555 555 coexpression:554
Rv1931c transcriptional regulator 468 468 ctx cooccurence:465
Rv0659c mazF2 toxin MazF2 421 422 coexpression:422
Rv0456A mazF1 toxin MazF1 416 417 coexpression:417
Rv2801c mazF9 mRNA interferase MazF9 416 417 coexpression:417
Rv1102c mazF3 mRNA interferase MazF3 416 417 coexpression:417
Rv1942c mazF5 toxin MazF5 414 415 coexpression:415
Rv1991c mazF6 mRNA interferase MazF6 414 415 coexpression:415
Rv1495 mazF4 mRNA interferase MazF4 412 413 coexpression:413
Rv2063A mazF7 mRNA interferase MazF7 412 413 coexpression:413
Rv3098A PemK-like protein 412 413 coexpression:413

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The exp badge marks an experimentally-supported partner (measured interaction, experimental/database channel ≥400) as opposed to a purely predicted one — but note that the M. tuberculosis experimental interactome is dominated by a noisy bacterial-two-hybrid screen, so a strong measured link that contradicts the operon/localisation context is likely a false positive. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: HTH-type transcriptional regulator
  • MTBC0 PGAP product: helix-turn-helix domain-containing protein
  • Pfam (hmmscan --cut_ga): HxlR PF01638.24 (E=5e-28), HTH_5 PF01022.27 (E=1e-04)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_217611.1)
  • Domains: Pfam-A via hmmscan --cut_ga — HxlR (PF01638.24), HTH_5 (PF01022.27)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG1733
  • Curated reference: UniProt P9WMG3 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Genome-wide structure: AlphaFold DB model (Jumper et al. 2021, doi:10.1038/s41586-021-03819-2; Varadi et al. 2024, doi:10.1093/nar/gkad1011) searched vs PDB with Foldseek (mean pLDDT 89.9)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 34 functional partner(s); context anchor Rv3093c
  • Essentiality: genome-wide transposon mutagenesis in H37Rv — DeJesus et al. 2017 (mBio, doi:10.1128/mBio.02133-16, CC BY)
  • Proteomics: integrated mass-spectrometry abundance from PaxDb 5.0 (Huang et al. 2023, doi:10.1016/j.mcpro.2023.100640), taxon 83332 — weighted average of 16 datasets, incl. Schubert et al. 2013 (doi:10.1016/j.chom.2013.04.008) and Albrethsen et al. 2013 (doi:10.1074/mcp.M112.018846)
  • Functional category: TubercuList scheme (Cole et al. 1998, doi:10.1038/31159), via Mycobrowser (Kapopoulou et al. 2011, doi:10.1016/j.tube.2010.09.006)
  • Orthologues: reciprocal best hits (DIAMOND, Buchfink et al. 2021, doi:10.1038/s41592-021-01101-x) against Mycobrowser release 5 reference proteomes
  • Genomic context / operon: H37Rv annotation; operon predicted by co-directional intergenic distance (Salgado et al. 2000, doi:10.1073/pnas.030539397)
  • Transcriptional regulation: ISB signed TRN — TF ChIP-seq (Minch et al. 2015, doi:10.1038/ncomms6829) + TF overexpression (Rustad et al. 2014, doi:10.1186/gb-2014-15-11-502)
  • Physico-chemical properties: ExPASy ProtParam method via Biopython (Gasteiger et al. 2005), computed from the MTBC0 sequence
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_003289|Rv3095|
MAVSDLSHRFEGESVGRALELVGERWTLLILREAFFGVRRFGQLARNLGIPRPTLSSRLRMLVEVGLFDRVPYSSDPERHEYRLTEAGRDLFAAIVVLMQWGDEYLPRPEGPPIKLRHHTCGEHADPRLICTHCGEEITARNVTPEPGPGFKAKLASS