ftsE Family assigned · medium auto-curated

H37Rv Rv3102c · MTBC0 mtbc0_003298 · 229 aa · 3492044–3492733 (-) · RefSeq NP_217618.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)cell division ATP-binding protein FtsE
MTBC0 PGAP re-annotationcell division ATP-binding protein FtsE
Revised (this work)Cell division ATP-binding protein FtsE. Pfam: ABC_tran (PF00005.34), AAA_21 (PF13304.13).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt O05779 SwissProt · reviewed · Evidence at protein level
UniProt nameCell division ATP-binding protein FtsE
Curated functionPart of the ABC transporter FtsEX involved in cellular division. Has ATPase activity.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category D Cell cycle control, cell division, chromosome partitioning
Preferred nameftsE
eggNOG descriptioncell division ATP-binding protein FtsE
Orthologous groupCOG2884
KEGG orthology K09812
KEGG pathways map02010
KEGG modules M00256
Gene Ontology (36) GO:0000166, GO:0000287, GO:0003674, GO:0003824, GO:0005488, GO:0005524, GO:0005575, GO:0005623, GO:0005886, GO:0008144, GO:0016020, GO:0016462 +24 more

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.562 · relaxed/neutral
Polymorphic sites (≥ 0.1% of strains) 3 synonymous, 5 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
ABC_tranPF00005.34 8.0e-3519–166 ABC transporter
AAA_21PF13304.13 4.1e-0794–202 AAA domain, putative AbiEii toxin, Type IV TA system

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: ftsX (cell division protein FtsX), high confidence from genomic context alone (score 997 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv3101c ftsX cell division protein FtsX 999 997 ctx neighborhood:882 cooccurence:764 coexpression:892 textmining:974
Rv3100c smpB SsrA-binding protein 979 892 ctx neighborhood:882 textmining:819
Rv3099c hyp hypothetical protein 831 831 ctx neighborhood:830
Rv3105c prfB peptide chain release factor PrfB 742 730 ctx neighborhood:706
Rv3104c transmembrane protein 716 716 ctx neighborhood:706
Rv3103c hyp hypothetical protein 689 689 ctx neighborhood:682
Rv1477 ripA peptidoglycan endopeptidase RipA 691 568 coexpression:424
Rv3106 fprA NADPH-ferredoxin reductase FprA 527 527 ctx neighborhood:525
Rv1709 scpA segregation and condensation protein ScpA 533 515 coexpression:499
Rv3012c gatC glutamyl-tRNA(GLN) amidotransferase subunit C 454 455 coexpression:452
Rv2551c hyp hypothetical protein 437 437 coexpression:419
Rv3696c glpK glycerol kinase 408 409 coexpression:407
Rv2553c mltG membrane protein 415 394
Rv3598c lysS lysine--tRNA ligase 581 318 textmining:411
Rv2150c ftsZ cell division protein FtsZ 838 271 textmining:787

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: cell division ATP-binding protein FtsE
  • MTBC0 PGAP product: cell division ATP-binding protein FtsE
  • Pfam (hmmscan --cut_ga): ABC_tran PF00005.34 (E=8e-35), AAA_21 PF13304.13 (E=4e-07)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_217618.1)
  • Domains: Pfam-A via hmmscan --cut_ga — ABC_tran (PF00005.34), AAA_21 (PF13304.13)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG2884
  • Curated reference: UniProt O05779 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 48 functional partner(s); context anchor ftsX
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_003298|Rv3102c|ftsE
MITLDHVTKQYKSSARPALDDINVKIDKGEFVFLIGPSGSGKSTFMRLLLAAETPTSGDVRVSKFHVNKLRGRHVPKLRQVIGCVFQDFRLLQQKTVYDNVAFALEVIGKRTDAINRVVPEVLETVGLSGKANRLPDELSGGEQQRVAIARAFVNRPLVLLADEPTGNLDPETSRDIMDLLERINRTGTTVLMATHDHHIVDSMRQRVVELSLGRLVRDEQRGVYGMDR