ftsE Family assigned · medium auto-curated
H37Rv Rv3102c · MTBC0 mtbc0_003298 ·
229 aa · 3492044–3492733 (-) ·
RefSeq NP_217618.1
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | cell division ATP-binding protein FtsE |
|---|---|
| MTBC0 PGAP re-annotation | cell division ATP-binding protein FtsE |
| Revised (this work) | Cell division ATP-binding protein FtsE. Pfam: ABC_tran (PF00005.34), AAA_21 (PF13304.13). |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
Curated reference (UniProt)
| UniProt |
O05779
SwissProt · reviewed
· Evidence at protein level
|
|---|---|
| UniProt name | Cell division ATP-binding protein FtsE |
| Curated function | Part of the ABC transporter FtsEX involved in cellular division. Has ATPase activity. |
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
D Cell cycle control, cell division, chromosome partitioning
|
|---|---|
| Preferred name | ftsE |
| eggNOG description | cell division ATP-binding protein FtsE |
| Orthologous group | COG2884 |
| KEGG orthology |
K09812
|
| KEGG pathways |
map02010
|
| KEGG modules |
M00256
|
| Gene Ontology (36) |
GO:0000166, GO:0000287, GO:0003674, GO:0003824, GO:0005488, GO:0005524, GO:0005575, GO:0005623, GO:0005886, GO:0008144, GO:0016020, GO:0016462 +24 more
|
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS | 0.562 · relaxed/neutral |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 3 synonymous, 5 missense, 0 nonsense, 0 frameshift |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
ABC_tran | PF00005.34 | 8.0e-35 | 19–166 | ABC transporter |
AAA_21 | PF13304.13 | 4.1e-07 | 94–202 | AAA domain, putative AbiEii toxin, Type IV TA system |
Functional interaction network (STRING v12, guilt-by-association)
Closest characterised functional partner: ftsX (cell division protein FtsX), high confidence from genomic context alone (score 997 excluding text-mining).
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv3101c ftsX |
cell division protein FtsX | 999 | 997 ctx | neighborhood:882 cooccurence:764 coexpression:892 textmining:974 |
Rv3100c smpB |
SsrA-binding protein | 979 | 892 ctx | neighborhood:882 textmining:819 |
Rv3099c hyp |
hypothetical protein | 831 | 831 ctx | neighborhood:830 |
Rv3105c prfB |
peptide chain release factor PrfB | 742 | 730 ctx | neighborhood:706 |
Rv3104c |
transmembrane protein | 716 | 716 ctx | neighborhood:706 |
Rv3103c hyp |
hypothetical protein | 689 | 689 ctx | neighborhood:682 |
Rv1477 ripA |
peptidoglycan endopeptidase RipA | 691 | 568 | coexpression:424 |
Rv3106 fprA |
NADPH-ferredoxin reductase FprA | 527 | 527 ctx | neighborhood:525 |
Rv1709 scpA |
segregation and condensation protein ScpA | 533 | 515 | coexpression:499 |
Rv3012c gatC |
glutamyl-tRNA(GLN) amidotransferase subunit C | 454 | 455 | coexpression:452 |
Rv2551c hyp |
hypothetical protein | 437 | 437 | coexpression:419 |
Rv3696c glpK |
glycerol kinase | 408 | 409 | coexpression:407 |
Rv2553c mltG |
membrane protein | 415 | 394 | |
Rv3598c lysS |
lysine--tRNA ligase | 581 | 318 | textmining:411 |
Rv2150c ftsZ |
cell division protein FtsZ | 838 | 271 | textmining:787 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Legacy H37Rv annotation: cell division ATP-binding protein FtsE
- MTBC0 PGAP product: cell division ATP-binding protein FtsE
- Pfam (hmmscan --cut_ga): ABC_tran PF00005.34 (E=8e-35), AAA_21 PF13304.13 (E=4e-07)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_217618.1)
- Domains: Pfam-A via hmmscan --cut_ga — ABC_tran (PF00005.34), AAA_21 (PF13304.13)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
COG2884 - Curated reference: UniProt O05779 (SwissProt, reviewed; Evidence at protein level)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
48 functional partner(s); context anchor
ftsX - Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>mtbc0_003298|Rv3102c|ftsE MITLDHVTKQYKSSARPALDDINVKIDKGEFVFLIGPSGSGKSTFMRLLLAAETPTSGDVRVSKFHVNKLRGRHVPKLRQVIGCVFQDFRLLQQKTVYDNVAFALEVIGKRTDAINRVVPEVLETVGLSGKANRLPDELSGGEQQRVAIARAFVNRPLVLLADEPTGNLDPETSRDIMDLLERINRTGTTVLMATHDHHIVDSMRQRVVELSLGRLVRDEQRGVYGMDR