rbfA Resolved · high auto-curated

H37Rv Rv2838c · MTBC0 mtbc0_003017 · 183 aa · 3165286–3165837 (-) · RefSeq NP_217354.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)ribosome-binding factor RbfA
MTBC0 PGAP re-annotation30S ribosome-binding factor RbfA
Revised (this work)30S ribosome-binding factor RbfA. Pfam: RBFA (PF02033.24).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt P9WHJ7 SwissProt · reviewed · Evidence at protein level
UniProt nameRibosome-binding factor A
Curated functionOne of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Associates with free 30S ribosomal subunits (but not with 30S subunits that are part of 70S ribosomes or polysomes). Required for efficient processing of 16S rRNA. May interact with the 5'-terminal helix region of 16S rRNA.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category J Translation, ribosomal structure and biogenesis
Preferred namerbfA
eggNOG descriptionOne of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Associates with free 30S ribosomal subunits (but not with 30S subunits that are part of 70S ribosomes or polysomes). Required for efficient processing of 16S rRNA. May interact with the 5'-terminal helix region of 16S rRNA
Orthologous groupCOG0858
KEGG orthology K02834

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.275 · purifying
Polymorphic sites (≥ 0.1% of strains) 4 synonymous, 3 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
RBFAPF02033.24 2.3e-256–113 Ribosome-binding factor A

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: infB (translation initiation factor IF-2), high confidence from genomic context alone (score 997 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv2839c infB translation initiation factor IF-2 998 997 ctx neighborhood:882 coexpression:969 textmining:611
Rv2837c nrnA bifunctional oligoribonuclease/PAP phosphatase NrnA 983 982 ctx neighborhood:882 coexpression:853
Rv2836c dinF DNA-damage-inducible protein DinF 895 882 ctx neighborhood:881
Rv2793c truB tRNA pseudouridine synthase B 967 876 coexpression:853 textmining:745
Rv2840c hyp hypothetical protein 870 870 ctx neighborhood:782 coexpression:429
Rv3459c rpsK 30S ribosomal protein S11 871 864 experimental:790
Rv0683 rpsG 30S ribosomal protein S7 891 859 experimental:790
Rv2842c rimP ribosome maturation factor RimP 892 830 ctx neighborhood:492 coexpression:416 experimental:474
Rv3458c rpsD 30S ribosomal protein S4 846 813 coexpression:648 experimental:474
Rv0710 rpsQ 30S ribosomal protein S17 898 812 coexpression:658 experimental:474 textmining:481
Rv0721 rpsE 30S ribosomal protein S5 848 812 coexpression:657 experimental:474
Rv2785c rpsO 30S ribosomal protein S15 949 810 coexpression:596 experimental:474 textmining:745
Rv2055c rpsR2 30S ribosomal protein S18 805 796 experimental:652
Rv2835c ugpA sn-glycerol-3-phosphate ABC transporter permease UgpA 783 784 ctx neighborhood:782
Rv2834c ugpE sn-glycerol-3-phosphate ABC transporter permease UgpE 782 783 ctx neighborhood:782

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: ribosome-binding factor RbfA
  • MTBC0 PGAP product: 30S ribosome-binding factor RbfA
  • Pfam (hmmscan --cut_ga): RBFA PF02033.24 (E=2e-25)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_217354.1)
  • Domains: Pfam-A via hmmscan --cut_ga — RBFA (PF02033.24)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG0858
  • Curated reference: UniProt P9WHJ7 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 99 functional partner(s); context anchor infB
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_003017|Rv2838c|rbfA
MADAARARRLAKRIAAIVASAIEYEIKDPGLAGVTITDAKVTADLHDATVYYTVMGRTLHDEPNCAGAAAALERAKGVLRTKVGAGTGVRFTPTLTFTLDTISDSVHRMDELLARARAADADLARVRVGAKPAGEADPYRDNGSVAQSPAPGGLGIRTSDGPEAVEAPLTCGGDTGDDDRPKE