nrnA Resolved · high auto-curated

H37Rv Rv2837c · MTBC0 mtbc0_003016 · 336 aa · 3164301–3165311 (-) · RefSeq NP_217353.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)bifunctional oligoribonuclease/PAP phosphatase NrnA
MTBC0 PGAP re-annotationbifunctional oligoribonuclease/PAP phosphatase NrnA
Revised (this work)Bifunctional oligoribonuclease/PAP phosphatase NrnA. Pfam: DHH (PF01368.28), DHHA1 (PF02272.25).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt P71615 SwissProt · reviewed · Evidence at protein level
UniProt nameBifunctional oligoribonuclease and PAP phosphatase NrnA
EC (curated) EC 3.1.-.-, EC 3.1.3.7
Curated functionBifunctional enzyme which has both oligoribonuclease and pAp-phosphatase activities. Degrades RNA oligonucleotides with a length of 5 nucleotides and shorter, with a preference for 2-mers. Also degrades 24-mers. Converts 3'(2')-phosphoadenosine 5'-phosphate (PAP) to AMP.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category J Translation, ribosomal structure and biogenesis
Preferred namenrnA
eggNOG descriptionPhosphoesterase
Orthologous groupCOG0618
EC number EC 3.1.13.3, EC 3.1.3.7
KEGG orthology K06881
KEGG pathways map00920, map01100, map01120
Gene Ontology (2) GO:0008150, GO:0040007

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.369 · purifying
Polymorphic sites (≥ 0.1% of strains) 1 synonymous, 1 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
DHHPF01368.28 1.0e-1436–177 DHH family, N-terminal domain
DHHA1PF02272.25 2.3e-08258–334 DHHA1 domain

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: rbfA (ribosome-binding factor RbfA), high confidence from genomic context alone (score 982 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv2838c rbfA ribosome-binding factor RbfA 983 982 ctx neighborhood:882 coexpression:853
Rv2839c infB translation initiation factor IF-2 965 963 ctx neighborhood:882 coexpression:703
Rv1286 cysC adenylyl-sulfate kinase 911 911 database:900
Rv2392 cysH phosphoadenosine phosphosulfate reductase 903 903 database:900
Rv1285 cysD sulfate adenylyltransferase subunit 2 902 903 database:900
Rv2131c cysQ 3'(2'),5'-bisphosphate nucleotidase CysQ 963 901 database:900 textmining:644
Rv2836c dinF DNA-damage-inducible protein DinF 927 881 ctx neighborhood:881 textmining:414
Rv2840c hyp hypothetical protein 805 805 ctx neighborhood:782
Rv2835c ugpA sn-glycerol-3-phosphate ABC transporter permease UgpA 784 785 ctx neighborhood:782
Rv2834c ugpE sn-glycerol-3-phosphate ABC transporter permease UgpE 744 744 ctx neighborhood:743
Rv2833c ugpB sn-glycerol-3-phosphate ABC transporter substrate-binding lipoprotein UgpB 743 744 ctx neighborhood:743
Rv2832c ugpC sn-glycerol-3-phosphate ABC transporter ATP-binding protein UgpC 572 573 ctx neighborhood:572
Rv2841c nusA transcription termination/antitermination protein NusA 535 535 ctx neighborhood:528
Rv3605c hyp hypothetical protein 526 526 ctx cooccurence:526
Rv2844 hyp hypothetical protein 516 516

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: bifunctional oligoribonuclease/PAP phosphatase NrnA
  • MTBC0 PGAP product: bifunctional oligoribonuclease/PAP phosphatase NrnA
  • Pfam (hmmscan --cut_ga): DHH PF01368.28 (E=1e-14), DHHA1 PF02272.25 (E=2e-08)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_217353.1)
  • Domains: Pfam-A via hmmscan --cut_ga — DHH (PF01368.28), DHHA1 (PF02272.25)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG0618
  • Curated reference: UniProt P71615 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 37 functional partner(s); context anchor rbfA
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_003016|Rv2837c|nrnA
MTTIDPRSELVDGRRRAGARVDAVGAAALLSAAARVGVVCHVHPDADTIGAGLALALVLDGCGKRVEVSFAAPATLPESLRSLPGCHLLVRPEVMRRDVDLVVTVDIPSVDRLGALGDLTDSGRELLVIDHHASNDLFGTANFIDPSADSTTTMVAEILDAWGKPIDPRVAHCIYAGLATDTGSFRWASVRGYRLAARLVEIGVDNATVSRTLMDSHPFTWLPLLSRVLGSAQLVSEAVGGRGLVYVVVDNREWVAARSEEVESIVDIVRTTQQAEVAAVFKEVEPHRWSVSMRAKTVNLAAVASGFGGGGHRLAAGYTTTGSIDDAVASLRAALG