nrnA Resolved · high auto-curated
H37Rv Rv2837c · MTBC0 mtbc0_003016 ·
336 aa ·
3164301–3165311 MTBC0
(-) ·
RefSeq NP_217353.1
Genomic neighbourhood (genome browser)
Open in full genome browser →This gene (outlined) in its genomic context; arrows are neighbouring genes coloured by verdict. Click any gene to navigate. Pan and zoom in the full browser.
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | bifunctional oligoribonuclease/PAP phosphatase NrnA |
|---|---|
| MTBC0 PGAP re-annotation | bifunctional oligoribonuclease/PAP phosphatase NrnA |
| Revised (this work) | Bifunctional oligoribonuclease/PAP phosphatase NrnA. Pfam: DHH (PF01368.28), DHHA1 (PF02272.25). |
| Functional category (TubercuList) | conserved hypotheticals |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
In the literature (TB corpus sweep) 14 publications
14 TB publications mention this gene. 14 publication(s) discuss this gene (12 in a M. tuberculosis context, 4 in other mycobacteria — M. smegmatis (3)).
| Publication | Date |
|---|---|
| Discovery of natural CdnP inhibitors through structure-based virtual screening and molecular dynamics simulations. doi:10.1128/spectrum.03258-24 | 2025 |
| NrnA is a 5'-3' exonuclease that processes short RNA substrates in vivo and in vitro. doi:10.1093/nar/gkac1091 | 2022 |
| Cyclic-di-AMP Phosphodiesterase Elicits Protective Immune Responses Against Mycobacterium tuberculosis H37Ra Infection in Mice. doi:10.3389/fcimb.2022.871135 | 2022 |
| c-di-AMP Accumulation Regulates Growth, Metabolism, and Immunogenicity of Mycobacterium smegmatis. doi:10.3389/fmicb.2022.865045 | 2022 |
| Regulation of the CRISPR-Associated Genes by Rv2837c (CnpB) via an Orn-Like Activity in Tuberculosis Complex Mycobacteria. doi:10.1128/JB.00743-17 | 2018 |
This layer CITES the literature and adds context; it does not change the verdict or the function stated elsewhere in this fiche. This distinguishes a gene that is dark because nobody has looked from one that is dark despite having been studied. Source: PubMed (whole): H37Rv locus tag + GENE NAME + ortholog identifiers (Mb…, MMAR_…, MSMEG_…, ML…, MAB_…), under a mycobacterial context filter; hits verified against the abstract text. Species-context counts distinguish M. tuberculosis literature from literature on other mycobacteria. phase76/phase77, 2026-07-13.
Genomic-neighbour overlap (structural caveat) co-directional · 3 % of gene
| Neighbour | rbfA (Rv2838c, - strand) |
|---|---|
| Overlap | 26 bp, 3 % of this gene's length |
co-directional overlap: ordinary (e.g. shared stop/start codons in an operon), not the Rv2438A-type artefact P20.1, derived from GFF3 gene coordinates, 2026-08-03.
Conditional expression context (iModulons)
Member of 1 independently-modulated gene set(s):
Nucleic Acid Hydrolysis .
iModulon membership (independently-modulated gene sets from a 647-sample RNA-seq compendium): the conditional co-expression context. Co-expression is a regulatory context, NOT a molecular function. Source: iModulonDB / modulome_mtb (Yoo 2022).
CRISPRi vulnerability
Vulnerability index -4.31 (95% CI -6.95 to -0.59). A more negative index = more vulnerable to knockdown (better drug-target quality); indicative threshold VI ≤ -6 = highly vulnerable.
Quantitative CRISPRi knockdown, graded (finer than binary Tn-seq essentiality). Source: CRISPRi vulnerability index (Bosch 2021, pebble.rockefeller.edu).
Legacy record & comparison (Mycobrowser) ahead of Mycobrowser
| Mycobrowser function | Function unknown |
|---|
Mycobrowser classes this locus among conserved hypotheticals; the atlas now assigns a functional handle (curated function (UniProt), EC number, COG category, requalified function). Mycobrowser is no longer maintained, so its EC numbers predate recent nomenclature revisions (e.g. the 2018 EC 7 "translocase" class) — most EC differences are re-numberings of the same enzyme, not conflicts.
Orthologues (reciprocal best hits across mycobacteria)
| M. bovis |
Mb2862c
· 99.7% identity |
|---|---|
| M. marinum |
MMAR_1896
· 79.4% identity |
| M. smegmatis |
MSMEG_2630
· 73.1% identity |
| M. orygis |
RJtmp_002925
· 99.7% identity |
| M. abscessus |
MAB_3129c
· 64.6% identity |
Reciprocal-best-hit orthologues (DIAMOND) against the Mycobrowser reference proteomes. A missing species is informative: e.g. a gene absent from M. leprae was likely lost in its reductive genome evolution. Locus tags link to Mycobrowser.
Curated reference (UniProt)
| UniProt |
P71615
SwissProt · reviewed
· Evidence at protein level
|
|---|---|
| UniProt name | Bifunctional oligoribonuclease and PAP phosphatase NrnA |
| EC (curated) |
EC 3.1.-.-, EC 3.1.3.7
|
| Curated function | Bifunctional enzyme which has both oligoribonuclease and pAp-phosphatase activities. Degrades RNA oligonucleotides with a length of 5 nucleotides and shorter, with a preference for 2-mers. Also degrades 24-mers. Converts 3'(2')-phosphoadenosine 5'-phosphate (PAP) to AMP. |
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
J Translation, ribosomal structure and biogenesis
|
|---|---|
| Preferred name | nrnA |
| eggNOG description | Phosphoesterase |
| Orthologous group | COG0618 |
| EC number |
EC 3.1.13.3, EC 3.1.3.7
|
| KEGG orthology |
K06881
|
| KEGG pathways |
map00920, map01100, map01120
|
| Gene Ontology (2) |
GO:0008150, GO:0040007
|
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS | 0.369 · purifying |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 1 synonymous, 1 missense, 0 nonsense, 0 frameshift |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Outgroup conservation (beyond the MTBC) Corynebacteriales
| M. canettii dN/dS (deep-divergence selection) |
0.0 (low power)
· 5 consensus substitution(s) low power (5 canettii-consensus substitution(s)); present in M. canettii but dN/dS not reliable |
|---|---|
| Genus-wide presence (~53 non-MTBC Mycobacterium) |
present in 51/53 (96%) · mean identity 79.7%
· 4/4 closest MTBAP relatives conserved across the genus (present in 51/53 non-MTBC Mycobacterium genomes, incl. distant relatives) — an ancient core gene predating the genus radiation |
| Phylostratum (deepest detected homolog) |
MTBC-specific → Mycobacterium → Mycobacteriaceae → Corynebacteriales → Actinomycetia → Bacteria detected in 7/13 non-Mycobacterium reference genomes (down to Corynebacteriales) · mean identity 48.7% detected across the order Corynebacteriales (Corynebacterium/Nocardia/Rhodococcus/…) but not in more distant Actinomycetia — a Corynebacteriales-level gene |
Two orthogonal outgroup signals. M. canettii (the immediate outgroup) gives a deep-divergence dN/dS (a low value confirms a constrained, real gene; shown as confident only at ≥8 substitutions, else flagged low-power). Genus-wide presence/absence (tblastn vs assembled non-MTBC genomes) places the gene on the ancient-core ↔ MTBC-specific axis: a gene absent even from the closest MTBAP relatives is a candidate MTBC-specific innovation (possible host-adaptation factor, to confirm by synteny). The phylostratum extends that axis outside the genus (tblastn vs 13 reference genomes spanning Mycobacteriaceae → Corynebacteriales → Actinomycetia → outside the phylum): it is the deepest clade in which a homolog is still detected, i.e. a proxy for gene age. Read it with the null model in mind: a shallow (young) stratum can also reflect homology-detection failure for short or fast-evolving ORFs, so it is a descriptive axis, not a proof of novelty.
Essentiality (transposon mutagenesis)
| DeJesus 2017 call | NE · non-essential |
|---|---|
| What the call means | non-essential |
| TA sites (Himar1) | 14 in the ORF — 0 in the essential state, 0 growth-defect, 14 non-essential, 0 growth-advantage. Saturation 1.000, mean read count 19.0714285714. A region of the protein devoid of TA sites is invisible to this assay: nothing can be inferred about it, in either direction. |
Genome-wide Himar1 transposon essentiality in H37Rv (DeJesus 2017). An essential call (ES/ESD/GD) is strong, independent evidence that a "hypothetical" locus encodes a functional, selectively required gene — orthogonal to intra-species conservation.
Mutant phenotypes (conditional Tn-seq, MtbTnDB) in-vivo phenotype
| Condition | log2FC | q | Effect |
|---|---|---|---|
| Mutants exhibiting altered fitness in the absence of gene marP (other) | -5.74 | 0.0 | required |
| fitness in mouse infection (in vivo) | +4.66 | 0.0 | disruption advantageous |
| Differential genetic requirements of clinical Mtb strain (ID=632) from East Asian lineage (compared to H37Rv control) (strain background) | +4.09 | 0.0 | required |
| altered fitness under Vancomycin (drug exposure) | -3.69 | 0.0062 | required |
| fitness in mouse infection, day 45 (in vivo) | -2.55 | 0.029 | required |
| fitness in mouse infection (in vivo) | +1.81 | 0.0 | disruption advantageous |
Conditional fitness of transposon-disruption mutants across 6 significant condition(s) (|log2FC|≥1, q≤0.05), from the standardized MtbTnDB compendium. A negative log2FC means the mutant is depleted — the gene contributes to fitness in that condition. An in-vivo defect for a "hypothetical" is strong evidence it matters for infection, even without a known molecular function. Disruption (Tn insertion), not a clean deletion; genetic-interaction screens excluded.
Proteomics (mass spectrometry) detected
| MS detection | detected in 14 of 16 independent MS datasets |
|---|---|
| Integrated abundance | 140.0 ppm · rank 1057/3519 (70.0th percentile) |
Detection by mass spectrometry is direct, experimental evidence that the protein product exists — orthogonal to sequence conservation and to Tn-seq essentiality, and especially decisive for a "hypothetical" locus. Reproducible detection across several independent datasets (PaxDb) makes the existence claim robust; the integrated abundance places the protein in the proteome's dynamic range.
Physico-chemical properties (computed, ProtParam)
| Length | 336 aa |
|---|---|
| Molecular weight | 35.4 kDa |
| Theoretical pI | 5.6 |
| GRAVY | 0.199 (hydrophobic) |
| Aliphatic index | 103.3 |
| Aromaticity | 0.048 |
| Instability index | 28.8 (stable) |
Computed from the ancestral MTBC0 sequence with the ExPASy ProtParam method (Biopython). Descriptive biophysical context: a positive GRAVY flags a hydrophobic (often membrane) protein, a high instability index (>40) predicts a short in-vitro half-life, an extreme pI hints at compartment or binding partner.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
DHH | PF01368.28 | 1.0e-14 | 36–177 | DHH family, N-terminal domain |
DHHA1 | PF02272.25 | 2.3e-08 | 258–334 | DHHA1 domain |
Experimental structures (Protein Data Bank) 2 solved
| PDB | Method | Resolution | Coverage |
|---|---|---|---|
5cet |
X-ray diffraction | 2.0 Å | 97% |
5jju |
X-ray diffraction | 2.312 Å | 97% |
Experimentally solved structures mapped from the UniProt accession via PDBe/SIFTS (2 total; up to 8 shown, ranked by sequence coverage then resolution). An experimental structure is direct proof of the folded product and the strongest structural evidence — superseding the predicted ESMFold/AlphaFold models below for any covered region.
Structural search (AlphaFold DB model, Foldseek vs PDB — genome-wide) pLDDT 92.8
| PDB hit | prob | TM-score | E-value | Description |
|---|---|---|---|---|
5jju-assembly1_B |
1.00 | 0.99 | 5.5e-62 sig | 5jju-assembly1_B Crystal structure of Rv2837c complexed with 5'-pApA and 5'-AMP |
4ls9-assembly1_B |
1.00 | 0.78 | 2.5e-52 sig | 4ls9-assembly1_B Structure of mycobacterial nrnA homolog reveals multifunctional nuclease activities |
5o4z-assembly1_A |
1.00 | 0.89 | 4.1e-30 sig | 5o4z-assembly1_A Structure of the inactive T.maritima PDE (TM1595) D80N D154N mutant with substrate 5'-pApA |
5o25-assembly1_B |
1.00 | 0.84 | 6.6e-29 sig | 5o25-assembly1_B Structure of wildtype T.maritima PDE (TM1595) in ligand-free state |
4py9-assembly1_A |
1.00 | 0.82 | 1.1e-24 sig | 4py9-assembly1_A Crystal structure of an exopolyphosphatase-related protein from Bacteroides Fragilis. Northeast Structural Genomics target BFR192 |
Foldseek search of the AlphaFold DB model (mean pLDDT 92.8, gated at 70) against the PDB — a genome-wide extension of the ESMFold dark-gene search that also covers proteins beyond the single-sequence length limit. Confident structural neighbours (E < 0.01) shown.
Genomic context (neighbours & predicted operon) operon of 4
| Upstream (5' on genome) | dinF (- strand, 6 bp gap) |
|---|---|
| Downstream (3' on genome) | rbfA (- strand, -26 bp gap) |
| Predicted operon |
dinF · Rv2837c · rbfA · infB
|
Neighbours from the H37Rv annotation (- strand). The operon is predicted by co-directional intergenic distance (same strand, gaps ≤50 bp) — a transcription-unit hypothesis, not a mapped TSS. For a "hypothetical", co-transcription with a characterised operon is a concrete functional lead (complements the STRING neighborhood channel below).
Transcriptional regulation (signed TRN: ChIP-seq + TFOE)
| Regulated by (1 TF) |
kstR (represses)
|
|---|
Regulatory edges from the ISB signed transcriptional regulatory network (TF ChIP-seq binding, Minch 2015 + TF-overexpression response, Rustad 2014). An edge is regulatory evidence (binding and/or expression change), not necessarily direct. For a "hypothetical", membership in a known regulon (e.g. DosR dormancy, PhoP virulence) is a strong physiological-context lead.
Functional interaction network (STRING v12, guilt-by-association)
Explore full network →Node colour = verdict, dashed = hypothetical; edge colour = evidence (green experimental, orange genomic-context, grey co-expression), width ∝ score. Click a partner to open its page; "Explore full network" to walk the graph.
Closest characterised functional partner: rbfA (ribosome-binding factor RbfA), high confidence from genomic context alone (score 982 excluding text-mining).
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv2838c rbfA |
ribosome-binding factor RbfA | 983 | 982 ctx | neighborhood:882 coexpression:853 |
Rv2839c infB |
translation initiation factor IF-2 | 965 | 963 ctx | neighborhood:882 coexpression:703 |
Rv1286 cysC exp |
adenylyl-sulfate kinase | 911 | 911 | database:900 |
Rv2392 cysH exp |
phosphoadenosine phosphosulfate reductase | 903 | 903 | database:900 |
Rv1285 cysD exp |
sulfate adenylyltransferase subunit 2 | 902 | 903 | database:900 |
Rv2131c cysQ exp |
3'(2'),5'-bisphosphate nucleotidase CysQ | 963 | 901 | database:900 textmining:644 |
Rv2836c dinF |
DNA-damage-inducible protein DinF | 927 | 881 ctx | neighborhood:881 textmining:414 |
Rv2840c hyp |
hypothetical protein | 805 | 805 ctx | neighborhood:782 |
Rv2835c ugpA |
sn-glycerol-3-phosphate ABC transporter permease UgpA | 784 | 785 ctx | neighborhood:782 |
Rv2834c ugpE |
sn-glycerol-3-phosphate ABC transporter permease UgpE | 744 | 744 ctx | neighborhood:743 |
Rv2833c ugpB |
sn-glycerol-3-phosphate ABC transporter substrate-binding lipoprotein UgpB | 743 | 744 ctx | neighborhood:743 |
Rv2832c ugpC |
sn-glycerol-3-phosphate ABC transporter ATP-binding protein UgpC | 572 | 573 ctx | neighborhood:572 |
Rv2841c nusA |
transcription termination/antitermination protein NusA | 535 | 535 ctx | neighborhood:528 |
Rv3605c hyp |
hypothetical protein | 526 | 526 ctx | cooccurence:526 |
Rv2844 hyp |
hypothetical protein | 516 | 516 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The exp badge marks an experimentally-supported partner (measured interaction, experimental/database channel ≥400) as opposed to a purely predicted one — but note that the M. tuberculosis experimental interactome is dominated by a noisy bacterial-two-hybrid screen, so a strong measured link that contradicts the operon/localisation context is likely a false positive. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Legacy H37Rv annotation: bifunctional oligoribonuclease/PAP phosphatase NrnA
- MTBC0 PGAP product: bifunctional oligoribonuclease/PAP phosphatase NrnA
- Pfam (hmmscan --cut_ga): DHH PF01368.28 (E=1e-14), DHHA1 PF02272.25 (E=2e-08)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_217353.1)
- Domains: Pfam-A via hmmscan --cut_ga — DHH (PF01368.28), DHHA1 (PF02272.25)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
COG0618 - Curated reference: UniProt P71615 (SwissProt, reviewed; Evidence at protein level)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Genome-wide structure: AlphaFold DB model (Jumper et al. 2021, doi:10.1038/s41586-021-03819-2; Varadi et al. 2024, doi:10.1093/nar/gkad1011) searched vs PDB with Foldseek (mean pLDDT 92.8)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
37 functional partner(s); context anchor
rbfA - Essentiality: genome-wide transposon mutagenesis in H37Rv — DeJesus et al. 2017 (mBio, doi:10.1128/mBio.02133-16, CC BY)
- Proteomics: integrated mass-spectrometry abundance from PaxDb 5.0 (Huang et al. 2023, doi:10.1016/j.mcpro.2023.100640), taxon 83332 — weighted average of 16 datasets, incl. Schubert et al. 2013 (doi:10.1016/j.chom.2013.04.008) and Albrethsen et al. 2013 (doi:10.1074/mcp.M112.018846)
- Functional category: TubercuList scheme (Cole et al. 1998, doi:10.1038/31159), via Mycobrowser (Kapopoulou et al. 2011, doi:10.1016/j.tube.2010.09.006)
- Orthologues: reciprocal best hits (DIAMOND, Buchfink et al. 2021, doi:10.1038/s41592-021-01101-x) against Mycobrowser release 5 reference proteomes
- Experimental structures: PDBe/SIFTS UniProt→PDB mapping (Dana et al. 2019, doi:10.1093/nar/gky1114)
- Genomic context / operon: H37Rv annotation; operon predicted by co-directional intergenic distance (Salgado et al. 2000, doi:10.1073/pnas.030539397)
- Transcriptional regulation: ISB signed TRN — TF ChIP-seq (Minch et al. 2015, doi:10.1038/ncomms6829) + TF overexpression (Rustad et al. 2014, doi:10.1186/gb-2014-15-11-502)
- Mutant phenotypes: standardized Tn-seq compendium MtbTnDB (Jinich et al. 2025, doi:10.1111/mmi.15370), aggregating many primary Tn-seq studies across conditions
- Physico-chemical properties: ExPASy ProtParam method via Biopython (Gasteiger et al. 2005), computed from the MTBC0 sequence
- Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>mtbc0_003016|Rv2837c|nrnA MTTIDPRSELVDGRRRAGARVDAVGAAALLSAAARVGVVCHVHPDADTIGAGLALALVLDGCGKRVEVSFAAPATLPESLRSLPGCHLLVRPEVMRRDVDLVVTVDIPSVDRLGALGDLTDSGRELLVIDHHASNDLFGTANFIDPSADSTTTMVAEILDAWGKPIDPRVAHCIYAGLATDTGSFRWASVRGYRLAARLVEIGVDNATVSRTLMDSHPFTWLPLLSRVLGSAQLVSEAVGGRGLVYVVVDNREWVAARSEEVESIVDIVRTTQQAEVAAVFKEVEPHRWSVSMRAKTVNLAAVASGFGGGGHRLAAGYTTTGSIDDAVASLRAALG
Spot an error? Suggest an improvement
Found a mistake, a missing reference, or have a better functional hypothesis for nrnA? Email the maintainer — the message is pre-filled with this gene's details.