rpsR2 Resolved · high auto-curated
H37Rv Rv2055c · MTBC0 mtbc0_002188 ·
88 aa ·
2342700–2342966 MTBC0
(-) ·
RefSeq NP_216571.1
Genomic neighbourhood (genome browser)
Open in full genome browser →This gene (outlined) in its genomic context; arrows are neighbouring genes coloured by verdict. Click any gene to navigate. Pan and zoom in the full browser.
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | 30S ribosomal protein S18 |
|---|---|
| MTBC0 PGAP re-annotation | 30S ribosomal protein S18 |
| Revised (this work) | 30S ribosomal protein S18. Pfam: Ribosomal_S18 (PF01084.27). |
| Functional category (TubercuList) | information pathways |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
In the literature (TB corpus sweep) never studied
No publication mentions this gene in its title or abstract — not under its H37Rv locus tag, not under its gene name, and not under any ortholog identifier. Its annotation rests on sequence/structure evidence, with no primary study behind it.
This layer CITES the literature and adds context; it does not change the verdict or the function stated elsewhere in this fiche. This distinguishes a gene that is dark because nobody has looked from one that is dark despite having been studied. Source: PubMed (whole): H37Rv locus tag + GENE NAME + ortholog identifiers (Mb…, MMAR_…, MSMEG_…, ML…, MAB_…), under a mycobacterial context filter; hits verified against the abstract text. Species-context counts distinguish M. tuberculosis literature from literature on other mycobacteria. phase76/phase77, 2026-07-13.
Intrinsic disorder (sequence + structure) partially disordered
| Predicted disorder | 27% of residues (metapredict) · mean AlphaFold pLDDT 79.9 |
|---|---|
| Disordered regions | 1 IDR(s), longest 18 aa [0-18] |
carries a substantial disordered region (18/88 residues); disorder is a property, not a function
A property (biophysics), not a function. No LLPS/condensate claim is made from disorder alone. Verdict unchanged. Source: metapredict v3 (Emenecker/Holehouse) per-residue disorder + AlphaFold mean pLDDT (annotation_mtbc P16.13).
Conditional expression context (iModulons)
Member of 1 independently-modulated gene set(s):
Zur (zur).
iModulon membership (independently-modulated gene sets from a 647-sample RNA-seq compendium): the conditional co-expression context. Co-expression is a regulatory context, NOT a molecular function. Source: iModulonDB / modulome_mtb (Yoo 2022).
CRISPRi vulnerability
Vulnerability index 0.29 (95% CI -0.87 to 1.80). A more negative index = more vulnerable to knockdown (better drug-target quality); indicative threshold VI ≤ -6 = highly vulnerable.
Quantitative CRISPRi knockdown, graded (finer than binary Tn-seq essentiality). Source: CRISPRi vulnerability index (Bosch 2021, pebble.rockefeller.edu).
Legacy record & comparison (Mycobrowser)
| Mycobrowser function | Involved in translation, amino-acyl tRNA binding |
|---|
The legacy Mycobrowser record is shown for verification. Mycobrowser is no longer maintained; its EC numbers predate recent nomenclature revisions, so a class change usually reflects re-numbering, not a conflict.
Orthologues (reciprocal best hits across mycobacteria)
| M. bovis |
Mb2081c
· 100.0% identity |
|---|---|
| M. marinum |
MMAR_0289
· 80.3% identity |
| M. smegmatis |
MSMEG_6065
· 63.4% identity |
| M. orygis |
RJtmp_002127
· 100.0% identity |
| M. abscessus |
MAB_0331c
· 82.5% identity |
Reciprocal-best-hit orthologues (DIAMOND) against the Mycobrowser reference proteomes. A missing species is informative: e.g. a gene absent from M. leprae was likely lost in its reductive genome evolution. Locus tags link to Mycobrowser.
Curated reference (UniProt)
| UniProt |
P9WH47
SwissProt · reviewed
· Inferred from homology
|
|---|---|
| UniProt name | Small ribosomal subunit protein bS18B |
| Curated function | Binds as a heterodimer with protein bS6 to the central domain of the 16S rRNA, where it helps stabilize the platform of the 30S subunit. |
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
J Translation, ribosomal structure and biogenesis
|
|---|---|
| Preferred name | rpsR |
| eggNOG description | Binds as a heterodimer with protein S6 to the central domain of the 16S rRNA, where it helps stabilize the platform of the 30S subunit |
| Orthologous group | COG0238 |
| KEGG orthology |
K02963
|
| KEGG pathways |
map03010
|
| KEGG modules |
M00178
|
| Gene Ontology (56) |
GO:0003674, GO:0003735, GO:0005198, GO:0005575, GO:0005618, GO:0005622, GO:0005623, GO:0005737, GO:0005829, GO:0005840, GO:0005886, GO:0006412 +44 more
|
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Outgroup conservation (beyond the MTBC) Bacteria
| M. canettii dN/dS (deep-divergence selection) |
0.0 (low power)
· 2 consensus substitution(s) low power (2 canettii-consensus substitution(s)); present in M. canettii but dN/dS not reliable |
|---|---|
| Genus-wide presence (~53 non-MTBC Mycobacterium) |
present in 53/53 (100%) · mean identity 65.0%
· 4/4 closest MTBAP relatives conserved across the genus (present in 53/53 non-MTBC Mycobacterium genomes, incl. distant relatives) — an ancient core gene predating the genus radiation |
| Phylostratum (deepest detected homolog) |
MTBC-specific → Mycobacterium → Mycobacteriaceae → Corynebacteriales → Actinomycetia → Bacteria detected in 13/13 non-Mycobacterium reference genomes (down to Bacteria) · mean identity 66.7% detected down to outside the phylum (Proteobacteria/Firmicutes controls) — a universally conserved, ancient bacterial gene |
Two orthogonal outgroup signals. M. canettii (the immediate outgroup) gives a deep-divergence dN/dS (a low value confirms a constrained, real gene; shown as confident only at ≥8 substitutions, else flagged low-power). Genus-wide presence/absence (tblastn vs assembled non-MTBC genomes) places the gene on the ancient-core ↔ MTBC-specific axis: a gene absent even from the closest MTBAP relatives is a candidate MTBC-specific innovation (possible host-adaptation factor, to confirm by synteny). The phylostratum extends that axis outside the genus (tblastn vs 13 reference genomes spanning Mycobacteriaceae → Corynebacteriales → Actinomycetia → outside the phylum): it is the deepest clade in which a homolog is still detected, i.e. a proxy for gene age. Read it with the null model in mind: a shallow (young) stratum can also reflect homology-detection failure for short or fast-evolving ORFs, so it is a descriptive axis, not a proof of novelty.
Essentiality (transposon mutagenesis)
| DeJesus 2017 call | GA · growth-advantage |
|---|---|
| What the call means | growth-advantage: insertions enriched |
| TA sites (Himar1) | 3 in the ORF — 0 in the essential state, 0 growth-defect, 0 non-essential, 3 growth-advantage. Saturation 1.000, mean read count 45. A region of the protein devoid of TA sites is invisible to this assay: nothing can be inferred about it, in either direction. |
| Caveat | Statistically thin call: only 3 TA (Himar1) sites in the whole ORF (atlas median 13; genes under 300 nt typically have very few). A DeJesus 2017 call built on so few independent observations is less robust than the same call on a longer gene, in either direction. Cross-check against the CRISPRi vulnerability index (independent of TA-site density) and, if this gene overlaps a neighbour (see Genomic-neighbour overlap section below), verify how many of its TA sites actually fall inside its own ORF. (P20.3) |
Genome-wide Himar1 transposon essentiality in H37Rv (DeJesus 2017). An essential call (ES/ESD/GD) is strong, independent evidence that a "hypothetical" locus encodes a functional, selectively required gene — orthogonal to intra-species conservation.
Proteomics (mass spectrometry) detected
| MS detection | detected in 8 of 16 independent MS datasets |
|---|---|
| Integrated abundance | 127.0 ppm · rank 1128/3519 (68.0th percentile) |
Detection by mass spectrometry is direct, experimental evidence that the protein product exists — orthogonal to sequence conservation and to Tn-seq essentiality, and especially decisive for a "hypothetical" locus. Reproducible detection across several independent datasets (PaxDb) makes the existence claim robust; the integrated abundance places the protein in the proteome's dynamic range.
Physico-chemical properties (computed, ProtParam)
| Length | 88 aa |
|---|---|
| Molecular weight | 9.7 kDa |
| Theoretical pI | 10.75 |
| GRAVY | -0.603 (hydrophilic) |
| Aliphatic index | 81.0 |
| Aromaticity | 0.034 |
| Instability index | 36.0 (stable) |
Computed from the ancestral MTBC0 sequence with the ExPASy ProtParam method (Biopython). Descriptive biophysical context: a positive GRAVY flags a hydrophobic (often membrane) protein, a high instability index (>40) predicts a short in-vitro half-life, an extreme pI hints at compartment or binding partner.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
Ribosomal_S18 | PF01084.27 | 2.1e-22 | 24–73 | Ribosomal protein S18 |
Structural search (AlphaFold DB model, Foldseek vs PDB — genome-wide) pLDDT 79.9
| PDB hit | prob | TM-score | E-value | Description |
|---|---|---|---|---|
8fr8-assembly1_o |
1.00 | 0.90 | 1.8e-06 sig | 8fr8-assembly1_o Structure of Mycobacterium smegmatis Rsh bound to a 70S translation initiation complex |
8cdu-assembly1_U |
1.00 | 0.91 | 4.5e-06 sig | 8cdu-assembly1_U Rnase R bound to a 30S degradation intermediate (main state) |
8cdv-assembly1_U |
1.00 | 0.89 | 1.2e-05 sig | 8cdv-assembly1_U Rnase R bound to a 30S degradation intermediate (state II) |
8p2h-assembly1_s |
1.00 | 0.90 | 1.5e-05 sig | 8p2h-assembly1_s Staphylococcus aureus 70S ribosome with elongation factor G locked with fusidic acid with a tRNA in pe/E chimeric state |
6dzk-assembly1_r |
1.00 | 0.71 | 7.5e-07 sig | 6dzk-assembly1_r Cryo-EM Structure of Mycobacterium smegmatis C(minus) 30S ribosomal subunit with MPY |
Foldseek search of the AlphaFold DB model (mean pLDDT 79.9, gated at 70) against the PDB — a genome-wide extension of the ESMFold dark-gene search that also covers proteins beyond the single-sequence length limit. Confident structural neighbours (E < 0.01) shown.
Genomic context (neighbours & predicted operon) operon of 4
| Upstream (5' on genome) | Rv2054 (+ strand, 248 bp gap) |
|---|---|
| Downstream (3' on genome) | rpsN2 (- strand, 0 bp gap) |
| Predicted operon |
rpsR2 · rpsN2 · rpmG1 · rpmB2
|
Neighbours from the H37Rv annotation (- strand). The operon is predicted by co-directional intergenic distance (same strand, gaps ≤50 bp) — a transcription-unit hypothesis, not a mapped TSS. For a "hypothetical", co-transcription with a characterised operon is a concrete functional lead (complements the STRING neighborhood channel below).
Transcriptional regulation (signed TRN: ChIP-seq + TFOE)
| Regulated by (2 TF) |
Rv0081 (represses) · zur (represses)
|
|---|
Regulatory edges from the ISB signed transcriptional regulatory network (TF ChIP-seq binding, Minch 2015 + TF-overexpression response, Rustad 2014). An edge is regulatory evidence (binding and/or expression change), not necessarily direct. For a "hypothetical", membership in a known regulon (e.g. DosR dormancy, PhoP virulence) is a strong physiological-context lead.
Functional interaction network (STRING v12, guilt-by-association)
Explore full network →Node colour = verdict, dashed = hypothetical; edge colour = evidence (green experimental, orange genomic-context, grey co-expression), width ∝ score. Click a partner to open its page; "Explore full network" to walk the graph.
Closest characterised functional partner: rpsF (30S ribosomal protein S6), high confidence from genomic context alone (score 1000 excluding text-mining).
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv2890c rpsB exp |
30S ribosomal protein S2 | 999 | 1000 | coexpression:732 experimental:997 database:540 |
Rv0053 rpsF exp |
30S ribosomal protein S6 | 999 | 1000 ctx | cooccurence:496 coexpression:731 experimental:997 textmining:404 |
Rv3459c rpsK exp |
30S ribosomal protein S11 | 999 | 1000 | coexpression:731 experimental:997 database:540 |
Rv2056c rpsN2 exp |
30S ribosomal protein S14 | 999 | 998 ctx | neighborhood:882 coexpression:908 experimental:870 textmining:781 |
Rv2058c rpmB2 exp |
50S ribosomal protein L28 | 999 | 995 ctx | neighborhood:882 coexpression:731 experimental:789 textmining:887 |
Rv2057c rpmG1 exp |
50S ribosomal protein L33 | 998 | 995 ctx | neighborhood:882 coexpression:687 experimental:870 textmining:614 |
Rv0710 rpsQ exp |
30S ribosomal protein S17 | 993 | 993 | coexpression:724 experimental:933 database:540 |
Rv2785c rpsO exp |
30S ribosomal protein S15 | 993 | 992 | coexpression:730 experimental:933 database:540 |
Rv0718 rpsH exp |
30S ribosomal protein S8 | 993 | 992 | coexpression:732 experimental:933 database:540 |
Rv0683 rpsG exp |
30S ribosomal protein S7 | 992 | 991 | coexpression:732 experimental:933 database:540 |
Rv0705 rpsS exp |
30S ribosomal protein S19 | 992 | 991 | coexpression:731 experimental:933 database:540 |
Rv0707 rpsC exp |
30S ribosomal protein S3 | 992 | 991 | coexpression:732 experimental:933 database:540 |
Rv3442c rpsI exp |
30S ribosomal protein S9 | 992 | 991 | coexpression:731 experimental:933 database:540 |
Rv0721 rpsE exp |
30S ribosomal protein S5 | 991 | 991 | coexpression:730 experimental:933 database:540 |
Rv0056 rplI exp |
50S ribosomal protein L9 | 989 | 988 | coexpression:731 experimental:933 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The exp badge marks an experimentally-supported partner (measured interaction, experimental/database channel ≥400) as opposed to a purely predicted one — but note that the M. tuberculosis experimental interactome is dominated by a noisy bacterial-two-hybrid screen, so a strong measured link that contradicts the operon/localisation context is likely a false positive. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Legacy H37Rv annotation: 30S ribosomal protein S18
- MTBC0 PGAP product: 30S ribosomal protein S18
- Pfam (hmmscan --cut_ga): Ribosomal_S18 PF01084.27 (E=2e-22)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_216571.1)
- Domains: Pfam-A via hmmscan --cut_ga — Ribosomal_S18 (PF01084.27)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
COG0238 - Curated reference: UniProt P9WH47 (SwissProt, reviewed; Inferred from homology)
- Genome-wide structure: AlphaFold DB model (Jumper et al. 2021, doi:10.1038/s41586-021-03819-2; Varadi et al. 2024, doi:10.1093/nar/gkad1011) searched vs PDB with Foldseek (mean pLDDT 79.9)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
140 functional partner(s); context anchor
rpsF - Essentiality: genome-wide transposon mutagenesis in H37Rv — DeJesus et al. 2017 (mBio, doi:10.1128/mBio.02133-16, CC BY)
- Proteomics: integrated mass-spectrometry abundance from PaxDb 5.0 (Huang et al. 2023, doi:10.1016/j.mcpro.2023.100640), taxon 83332 — weighted average of 16 datasets, incl. Schubert et al. 2013 (doi:10.1016/j.chom.2013.04.008) and Albrethsen et al. 2013 (doi:10.1074/mcp.M112.018846)
- Functional category: TubercuList scheme (Cole et al. 1998, doi:10.1038/31159), via Mycobrowser (Kapopoulou et al. 2011, doi:10.1016/j.tube.2010.09.006)
- Orthologues: reciprocal best hits (DIAMOND, Buchfink et al. 2021, doi:10.1038/s41592-021-01101-x) against Mycobrowser release 5 reference proteomes
- Genomic context / operon: H37Rv annotation; operon predicted by co-directional intergenic distance (Salgado et al. 2000, doi:10.1073/pnas.030539397)
- Transcriptional regulation: ISB signed TRN — TF ChIP-seq (Minch et al. 2015, doi:10.1038/ncomms6829) + TF overexpression (Rustad et al. 2014, doi:10.1186/gb-2014-15-11-502)
- Physico-chemical properties: ExPASy ProtParam method via Biopython (Gasteiger et al. 2005), computed from the MTBC0 sequence
- Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>mtbc0_002188|Rv2055c|rpsR2 MAAKSARKGPTKAKKNLLDSLGVESVDYKDTATLRVFISDRGKIRSRGVTGLTVQQQRQVAQAIKNAREMALLPYPGQDRQRRAALCP
Spot an error? Suggest an improvement
Found a mistake, a missing reference, or have a better functional hypothesis for rpsR2? Email the maintainer — the message is pre-filled with this gene's details.