rpsR2 Resolved · high auto-curated
H37Rv Rv2055c · MTBC0 mtbc0_002188 ·
88 aa · 2342700–2342966 (-) ·
RefSeq NP_216571.1
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | 30S ribosomal protein S18 |
|---|---|
| MTBC0 PGAP re-annotation | 30S ribosomal protein S18 |
| Revised (this work) | 30S ribosomal protein S18. Pfam: Ribosomal_S18 (PF01084.27). |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
Curated reference (UniProt)
| UniProt |
P9WH47
SwissProt · reviewed
· Inferred from homology
|
|---|---|
| UniProt name | Small ribosomal subunit protein bS18B |
| Curated function | Binds as a heterodimer with protein bS6 to the central domain of the 16S rRNA, where it helps stabilize the platform of the 30S subunit. |
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
J Translation, ribosomal structure and biogenesis
|
|---|---|
| Preferred name | rpsR |
| eggNOG description | Binds as a heterodimer with protein S6 to the central domain of the 16S rRNA, where it helps stabilize the platform of the 30S subunit |
| Orthologous group | COG0238 |
| KEGG orthology |
K02963
|
| KEGG pathways |
map03010
|
| KEGG modules |
M00178
|
| Gene Ontology (56) |
GO:0003674, GO:0003735, GO:0005198, GO:0005575, GO:0005618, GO:0005622, GO:0005623, GO:0005737, GO:0005829, GO:0005840, GO:0005886, GO:0006412 +44 more
|
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
Ribosomal_S18 | PF01084.27 | 2.1e-22 | 24–73 | Ribosomal protein S18 |
Functional interaction network (STRING v12, guilt-by-association)
Closest characterised functional partner: rpsF (30S ribosomal protein S6), high confidence from genomic context alone (score 1000 excluding text-mining).
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv2890c rpsB |
30S ribosomal protein S2 | 999 | 1000 | coexpression:732 experimental:997 database:540 |
Rv0053 rpsF |
30S ribosomal protein S6 | 999 | 1000 ctx | cooccurence:496 coexpression:731 experimental:997 textmining:404 |
Rv3459c rpsK |
30S ribosomal protein S11 | 999 | 1000 | coexpression:731 experimental:997 database:540 |
Rv2056c rpsN2 |
30S ribosomal protein S14 | 999 | 998 ctx | neighborhood:882 coexpression:908 experimental:870 textmining:781 |
Rv2058c rpmB2 |
50S ribosomal protein L28 | 999 | 995 ctx | neighborhood:882 coexpression:731 experimental:789 textmining:887 |
Rv2057c rpmG1 |
50S ribosomal protein L33 | 998 | 995 ctx | neighborhood:882 coexpression:687 experimental:870 textmining:614 |
Rv0710 rpsQ |
30S ribosomal protein S17 | 993 | 993 | coexpression:724 experimental:933 database:540 |
Rv2785c rpsO |
30S ribosomal protein S15 | 993 | 992 | coexpression:730 experimental:933 database:540 |
Rv0718 rpsH |
30S ribosomal protein S8 | 993 | 992 | coexpression:732 experimental:933 database:540 |
Rv0683 rpsG |
30S ribosomal protein S7 | 992 | 991 | coexpression:732 experimental:933 database:540 |
Rv0705 rpsS |
30S ribosomal protein S19 | 992 | 991 | coexpression:731 experimental:933 database:540 |
Rv0707 rpsC |
30S ribosomal protein S3 | 992 | 991 | coexpression:732 experimental:933 database:540 |
Rv3442c rpsI |
30S ribosomal protein S9 | 992 | 991 | coexpression:731 experimental:933 database:540 |
Rv0721 rpsE |
30S ribosomal protein S5 | 991 | 991 | coexpression:730 experimental:933 database:540 |
Rv0056 rplI |
50S ribosomal protein L9 | 989 | 988 | coexpression:731 experimental:933 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Legacy H37Rv annotation: 30S ribosomal protein S18
- MTBC0 PGAP product: 30S ribosomal protein S18
- Pfam (hmmscan --cut_ga): Ribosomal_S18 PF01084.27 (E=2e-22)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_216571.1)
- Domains: Pfam-A via hmmscan --cut_ga — Ribosomal_S18 (PF01084.27)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
COG0238 - Curated reference: UniProt P9WH47 (SwissProt, reviewed; Inferred from homology)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
140 functional partner(s); context anchor
rpsF - Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>mtbc0_002188|Rv2055c|rpsR2 MAAKSARKGPTKAKKNLLDSLGVESVDYKDTATLRVFISDRGKIRSRGVTGLTVQQQRQVAQAIKNAREMALLPYPGQDRQRRAALCP