rpsR2 Resolved · high auto-curated

H37Rv Rv2055c · MTBC0 mtbc0_002188 · 88 aa · 2342700–2342966 (-) · RefSeq NP_216571.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)30S ribosomal protein S18
MTBC0 PGAP re-annotation30S ribosomal protein S18
Revised (this work)30S ribosomal protein S18. Pfam: Ribosomal_S18 (PF01084.27).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt P9WH47 SwissProt · reviewed · Inferred from homology
UniProt nameSmall ribosomal subunit protein bS18B
Curated functionBinds as a heterodimer with protein bS6 to the central domain of the 16S rRNA, where it helps stabilize the platform of the 30S subunit.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category J Translation, ribosomal structure and biogenesis
Preferred namerpsR
eggNOG descriptionBinds as a heterodimer with protein S6 to the central domain of the 16S rRNA, where it helps stabilize the platform of the 30S subunit
Orthologous groupCOG0238
KEGG orthology K02963
KEGG pathways map03010
KEGG modules M00178
Gene Ontology (56) GO:0003674, GO:0003735, GO:0005198, GO:0005575, GO:0005618, GO:0005622, GO:0005623, GO:0005737, GO:0005829, GO:0005840, GO:0005886, GO:0006412 +44 more

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
Ribosomal_S18PF01084.27 2.1e-2224–73 Ribosomal protein S18

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: rpsF (30S ribosomal protein S6), high confidence from genomic context alone (score 1000 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv2890c rpsB 30S ribosomal protein S2 999 1000 coexpression:732 experimental:997 database:540
Rv0053 rpsF 30S ribosomal protein S6 999 1000 ctx cooccurence:496 coexpression:731 experimental:997 textmining:404
Rv3459c rpsK 30S ribosomal protein S11 999 1000 coexpression:731 experimental:997 database:540
Rv2056c rpsN2 30S ribosomal protein S14 999 998 ctx neighborhood:882 coexpression:908 experimental:870 textmining:781
Rv2058c rpmB2 50S ribosomal protein L28 999 995 ctx neighborhood:882 coexpression:731 experimental:789 textmining:887
Rv2057c rpmG1 50S ribosomal protein L33 998 995 ctx neighborhood:882 coexpression:687 experimental:870 textmining:614
Rv0710 rpsQ 30S ribosomal protein S17 993 993 coexpression:724 experimental:933 database:540
Rv2785c rpsO 30S ribosomal protein S15 993 992 coexpression:730 experimental:933 database:540
Rv0718 rpsH 30S ribosomal protein S8 993 992 coexpression:732 experimental:933 database:540
Rv0683 rpsG 30S ribosomal protein S7 992 991 coexpression:732 experimental:933 database:540
Rv0705 rpsS 30S ribosomal protein S19 992 991 coexpression:731 experimental:933 database:540
Rv0707 rpsC 30S ribosomal protein S3 992 991 coexpression:732 experimental:933 database:540
Rv3442c rpsI 30S ribosomal protein S9 992 991 coexpression:731 experimental:933 database:540
Rv0721 rpsE 30S ribosomal protein S5 991 991 coexpression:730 experimental:933 database:540
Rv0056 rplI 50S ribosomal protein L9 989 988 coexpression:731 experimental:933

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: 30S ribosomal protein S18
  • MTBC0 PGAP product: 30S ribosomal protein S18
  • Pfam (hmmscan --cut_ga): Ribosomal_S18 PF01084.27 (E=2e-22)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_216571.1)
  • Domains: Pfam-A via hmmscan --cut_ga — Ribosomal_S18 (PF01084.27)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG0238
  • Curated reference: UniProt P9WH47 (SwissProt, reviewed; Inferred from homology)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 140 functional partner(s); context anchor rpsF
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_002188|Rv2055c|rpsR2
MAAKSARKGPTKAKKNLLDSLGVESVDYKDTATLRVFISDRGKIRSRGVTGLTVQQQRQVAQAIKNAREMALLPYPGQDRQRRAALCP