Rv2828c Family assigned · low auto-curated

H37Rv Rv2828c · MTBC0 mtbc0_003003 · 181 aa · 3153558–3154103 (-) · RefSeq NP_217344.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)hypothetical protein
MTBC0 PGAP re-annotationDUF1802 family protein
Revised (this work)DUF1802 family protein.

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt I6X5G8 TrEMBL · unreviewed · Evidence at protein level
UniProt nameDUF1802 family protein

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category S Function unknown
eggNOG descriptionDomain of unknown function (DUF1802)
Orthologous groupCOG4293

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 2.676 · diversifying/relaxed
Polymorphic sites (≥ 0.1% of strains) 1 synonymous, 7 missense, 0 nonsense, 1 frameshift
Disruption 1 distinct premature-stop/frameshift site(s); most common in 0.63% of strains (917) · clonal

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
DUF1802PF08819.18 9.1e-564–174 Domain of unknown function (DUF1802)

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: vapC22 (ribonuclease VapC22), high confidence from genomic context alone (score 754 excluding text-mining). This association is the citable seed of a function hypothesis for this hypothetical protein.

PartnerProductScoreNo text-miningChannels (≥400)
Rv2825c hyp hypothetical protein 852 852 coexpression:804
Rv2828A hyp hypothetical protein 802 801 ctx neighborhood:801
Rv2829c vapC22 ribonuclease VapC22 755 754 ctx neighborhood:751
Rv2830c vapB22 antitoxin VapB22 753 753 ctx neighborhood:751
Rv3779 transmembrane protein 648 648 ctx cooccurence:648
Rv2831 echA16 enoyl-CoA hydratase EchA16 582 582 ctx neighborhood:581
Rv0048c membrane protein 544 544 ctx cooccurence:544
Rv0517 acyltransferase 526 526 ctx cooccurence:526
Rv0875c hyp hypothetical protein 517 517 ctx cooccurence:495
Rv2826c hyp hypothetical protein 437 437 ctx neighborhood:421
Rv2827c hyp hypothetical protein 432 432 ctx neighborhood:421
Rv1353c HTH-type transcriptional regulator 423 424 ctx cooccurence:420

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: hypothetical protein
  • MTBC0 PGAP product: DUF1802 family protein
  • Pfam (hmmscan --cut_ga): DUF1802 PF08819.18 (E=9e-56)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_217344.1)
  • Domains: Pfam-A via hmmscan --cut_ga — DUF1802 (PF08819.18)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG4293
  • Curated reference: UniProt I6X5G8 (TrEMBL, unreviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 12 functional partner(s); context anchor vapC22
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_003003|Rv2828c|
MTPALKEWSAAVHALLDGRQTVLLRKGGIGEKRFEVAAHEFLLFPTVAHSHAERVRPEHRDLLGPAAADSTDECVLLRAAAKVVAALPVNRPEGLDAIEDLHIWTAESVRADRLDFRPKHKLAVLVVCAIPLAEPVRLARRPEYGGCTSWVQLPLTPQLAEPVHDEAALAEVAARVREAVG