dinF Family assigned · medium auto-curated

H37Rv Rv2836c · MTBC0 mtbc0_003015 · 439 aa · 3162975–3164294 (-) · RefSeq NP_217352.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)DNA-damage-inducible protein DinF
MTBC0 PGAP re-annotationMATE family efflux transporter
Revised (this work)MATE family efflux transporter. Pfam: MatE (PF01554.24).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt P71616 TrEMBL · unreviewed · Inferred from homology
UniProt namePossible DNA-damage-inducible protein F DinF

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category V Defense mechanisms
Preferred namedinF
eggNOG descriptionEfflux protein, MATE family
Orthologous groupCOG0534

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.649 · relaxed/neutral
Polymorphic sites (≥ 0.1% of strains) 7 synonymous, 11 missense, 0 nonsense, 1 frameshift
Disruption 1 distinct premature-stop/frameshift site(s); most common in 0.24% of strains (348) · clonal

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
MatEPF01554.24 5.5e-2819–178 MatE

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: infB (translation initiation factor IF-2), high confidence from genomic context alone (score 883 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv2839c infB translation initiation factor IF-2 896 883 ctx neighborhood:881
Rv2838c rbfA ribosome-binding factor RbfA 895 882 ctx neighborhood:881
Rv2837c nrnA bifunctional oligoribonuclease/PAP phosphatase NrnA 927 881 ctx neighborhood:881 textmining:414
Rv2840c hyp hypothetical protein 898 810 ctx neighborhood:782 textmining:489
Rv2835c ugpA sn-glycerol-3-phosphate ABC transporter permease UgpA 781 782 ctx neighborhood:782
Rv3397c phyA phytoene synthase 790 777 coexpression:751
Rv1436 gap glyceraldehyde 3-phosphate dehydrogenase 730 712 coexpression:704
Rv1630 rpsA 30S ribosomal protein S1 703 703 coexpression:694
Rv2834c ugpE sn-glycerol-3-phosphate ABC transporter permease UgpE 673 674 ctx neighborhood:668
Rv2833c ugpB sn-glycerol-3-phosphate ABC transporter substrate-binding lipoprotein UgpB 668 668 ctx neighborhood:668
Rv2832c ugpC sn-glycerol-3-phosphate ABC transporter ATP-binding protein UgpC 569 569 ctx neighborhood:569
Rv0955 integral membrane protein 510 511 ctx cooccurence:476
Rv2842c rimP ribosome maturation factor RimP 512 492 ctx neighborhood:492
Rv2841c nusA transcription termination/antitermination protein NusA 492 492 ctx neighborhood:492
Rv3604c transmembrane protein 463 464 ctx cooccurence:460

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: DNA-damage-inducible protein DinF
  • MTBC0 PGAP product: MATE family efflux transporter
  • Pfam (hmmscan --cut_ga): MatE PF01554.24 (E=5e-28)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_217352.1)
  • Domains: Pfam-A via hmmscan --cut_ga — MatE (PF01554.24)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG0534
  • Curated reference: UniProt P71616 (TrEMBL, unreviewed; Inferred from homology)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 35 functional partner(s); context anchor infB
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_003015|Rv2836c|dinF
MSQVGHRAGGRQIAQLALPALGVLAAEPLYLLFDIAVVGRLGAISLAGLAIGSLVLGLVGSQATFLSYGTTARAARRYGAGNRVAAVTEGVQATWLALGLGALVVVVVEATATPLVSAIASGDGITAAALPWLRIAILGTPAILVSLAGNGWLRGVQDTVRPLRYVVAGFGSSALLCPLLVYGWLGLPRWGLTGSAVANLVGQWLAALLFAGALLAERVSLRPDRAVLGAQLMMARDLIVRTLAFQVCYVSAAAVAARFGAAALAAHQVVLQLWGLLALVLDSLAIAAQSLVGAALGAGDAGHAKAVAWRVTAFSLLAAGILAAALGLGSSVLPGLFTDDRSVLAAIGVPWWFMVVQLPFAGIVFAVDGVLLGAGDAAFMRTATVASALVGFLPLVWLSLAYGWGLAGIWSGLGTFIVLRLIFVGWRAYSGRWAVTGAA