Rv2843 Family assigned · low
H37Rv Rv2843 · MTBC0 mtbc0_003022 ·
181 aa · 3170837–3171382 (+) ·
RefSeq NP_217359.1
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | hypothetical protein |
|---|---|
| MTBC0 PGAP re-annotation | hypothetical protein |
| Revised (this work) | Small transmembrane protein, candidate subunit of the mycobacterial respiratory supercomplex (weak HHpred) RefSeq leaves this locus uncharacterised. |
Curated reference (UniProt)
| UniProt |
I6YAE2
TrEMBL · unreviewed
· Evidence at protein level
|
|---|---|
| UniProt name | Probable conserved transmembrane alanine rich protein |
Functional vocabulary (eggNOG-mapper, orthology transfer)
| Orthologous group | 2DYRJ |
|---|
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS | 0.0 · strong purifying |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 3 synonymous, 0 missense, 0 nonsense, 0 frameshift |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Domains (Pfam, hmmscan --cut_ga)
No Pfam-A domain above the gathering threshold (or not yet scanned).
Structural neighbours (Foldseek on the ESMFold model, exploratory)
ESMFold model confidence: mean pLDDT 84.1 (confident). A confident model makes the fold comparison meaningful.
Best matches against the PDB, ranked by Foldseek homology probability. A high probability / TM-score suggests a shared fold; unless flagged sig (E < 0.01) these are fold hypotheses, not assignments.
| Target | Prob | TM | E-value | Description |
|---|---|---|---|---|
8aav-assembly1_B |
0.97 | 0.63 | 5.9e-01 | 8aav-assembly1_B Human heavy chain ferritin with introduced Cys residues modified with C10 ligand |
8pp3-assembly1_B |
0.94 | 0.63 | 8.1e-01 | 8pp3-assembly1_B Binary crystal structure of positively supercharged ferritin variant Ftn(pos) and crystal contact tuned negatively supercharged ferritin variant Ftn(neg)-m1 (Mg formate condition) |
8pp3-assembly2_G |
0.92 | 0.63 | 9.4e-01 | 8pp3-assembly2_G Binary crystal structure of positively supercharged ferritin variant Ftn(pos) and crystal contact tuned negatively supercharged ferritin variant Ftn(neg)-m1 (Mg formate condition) |
8pp2-assembly1_D |
0.91 | 0.57 | 5.9e-01 | 8pp2-assembly1_D Binary crystal structure of positively supercharged ferritin variant Ftn(pos) and native(K86Q) human heavy chain ferritin (Mg formate condition) |
8pp2-assembly1_F |
0.91 | 0.59 | 6.6e-01 | 8pp2-assembly1_F Binary crystal structure of positively supercharged ferritin variant Ftn(pos) and native(K86Q) human heavy chain ferritin (Mg formate condition) |
6i9p-assembly1_A |
0.91 | 0.59 | 8.1e-01 | 6i9p-assembly1_A Iron-free state of Rana catesbeiana H' ferritin variant H54N |
8pp3-assembly2_I |
0.89 | 0.63 | 1.2e+00 | 8pp3-assembly2_I Binary crystal structure of positively supercharged ferritin variant Ftn(pos) and crystal contact tuned negatively supercharged ferritin variant Ftn(neg)-m1 (Mg formate condition) |
8pp5-assembly1_F |
0.89 | 0.63 | 1.2e+00 | 8pp5-assembly1_F Unitary crystal structure of positively supercharged ferritin variant Ftn(pos)-m1 (Mg Formate condition) |
Functional interaction network (STRING v12, guilt-by-association)
Closest characterised functional partner: nusA (transcription termination/antitermination protein NusA), high confidence from genomic context alone (score 762 excluding text-mining). This association is the citable seed of a function hypothesis for this hypothetical protein.
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv2844 hyp |
hypothetical protein | 913 | 913 ctx | neighborhood:882 |
Rv3835 hyp |
hypothetical protein | 772 | 773 ctx | cooccurence:772 |
Rv3909 hyp |
hypothetical protein | 770 | 770 ctx | cooccurence:767 |
Rv2841c nusA |
transcription termination/antitermination protein NusA | 762 | 762 ctx | neighborhood:760 |
Rv2842c rimP |
ribosome maturation factor RimP | 761 | 761 ctx | neighborhood:760 |
Rv2164c hyp |
hypothetical protein | 746 | 747 ctx | cooccurence:743 |
Rv0538 |
membrane protein | 743 | 744 ctx | cooccurence:742 |
Rv1024 |
membrane protein | 729 | 729 ctx | cooccurence:725 |
Rv0007 |
membrane protein | 719 | 720 ctx | cooccurence:719 |
Rv1111c hyp |
hypothetical protein | 708 | 709 ctx | cooccurence:706 |
Rv1752 hyp |
hypothetical protein | 697 | 698 ctx | cooccurence:695 |
Rv0010c |
membrane protein | 691 | 691 ctx | cooccurence:691 |
Rv0339c iniR |
transcriptional regulator | 683 | 684 ctx | cooccurence:683 |
Rv1648 |
transmembrane protein | 676 | 676 ctx | cooccurence:675 |
Rv2739c |
transferase | 664 | 665 ctx | cooccurence:661 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- HHpred (Neff 7.28, weak, no significant E): best biological hit 7Q21_l Actinobacteria respiratory supercomplex 84% E1.8 (same complex as Rv0615/Rv1892); top hit a generic 4-helix-bundle of unknown function; DeepTMHMM TM; strong purifying
- HHpred web (MPI Bioinformatics Toolkit, profile-profile remote homology), interpreted in project 'Still unknown gene function', 2026-06-10. A fold/family-level assignment, not a demonstrated function.
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_217359.1)
- Domains: Pfam-A via hmmscan --cut_ga — none above threshold
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
2DYRJ - Curated reference: UniProt I6YAE2 (TrEMBL, unreviewed; Evidence at protein level)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Model confidence: ESMFold per-residue pLDDT (mean 84.1, confident)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
62 functional partner(s); context anchor
nusA - Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>mtbc0_003022|Rv2843| MLRAAPVINRLTNRPISRRGVLAGGAALAALGVVSACGESAPKAPAVEELRSPLDQARHDGALAAAAATAIGIPPQVAAALTVVATQRTSHARALATEIARAAGKLVSATSETSSSSPSPTDPAAPPPAVSDVIDSLRTSAGEASRLVATTSGYRAGLLASIAASCTASYTVALVPSGPSI