Rv2840c Family assigned · medium auto-curated

H37Rv Rv2840c · MTBC0 - · 99 aa · 3147959–3148258 (-) · RefSeq NP_217356.3

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)hypothetical protein
MTBC0 PGAP re-annotation
Revised (this work)Contains YlxR (PF04296.19) domain(s); putative function inferred from the domain architecture.

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Annotated on the H37Rv protein: this gene has no 1:1 ancestral MTBC0 anchor (PE/PPE, paralogue, IS element, or otherwise unanchored CDS).

Curated reference (UniProt)

UniProt I6XFF7 TrEMBL · unreviewed · Predicted
UniProt nameYlxR domain-containing protein

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category K Transcription
eggNOG descriptionnucleic-acid-binding protein implicated in transcription termination
Orthologous groupCOG2740
KEGG orthology K07742

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS n/a
Polymorphic sites (≥ 0.1% of strains) 0 synonymous, 3 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
YlxRPF04296.19 3.1e-192–81 Protein of unknown function (DUF448)

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: nusA (transcription termination/antitermination protein NusA), high confidence from genomic context alone (score 960 excluding text-mining). This association is the citable seed of a function hypothesis for this hypothetical protein.

PartnerProductScoreNo text-miningChannels (≥400)
Rv2841c nusA transcription termination/antitermination protein NusA 960 960 ctx neighborhood:760 coexpression:840
Rv2839c infB translation initiation factor IF-2 960 955 ctx neighborhood:782 coexpression:804
Rv2842c rimP ribosome maturation factor RimP 957 951 ctx neighborhood:760 coexpression:805
Rv2838c rbfA ribosome-binding factor RbfA 870 870 ctx neighborhood:782 coexpression:429
Rv2836c dinF DNA-damage-inducible protein DinF 898 810 ctx neighborhood:782 textmining:489
Rv2837c nrnA bifunctional oligoribonuclease/PAP phosphatase NrnA 805 805 ctx neighborhood:782
Rv0682 rpsL 30S ribosomal protein S12 803 804 coexpression:804
Rv0703 rplW 50S ribosomal protein L23 681 681 coexpression:681
Rv3459c rpsK 30S ribosomal protein S11 671 671 coexpression:661
Rv2442c rplU 50S ribosomal protein L21 652 653 coexpression:651
Rv0702 rplD 50S ribosomal protein L4 643 644 coexpression:644
Rv1409 ribG bifunctional riboflavin biosynthesis diaminohydroxyphosphoribosylaminopyrimidine deaminase/5-amino-6-(5-phosphoribosylamino) uracil reductas 590 590
Rv0719 rplF 50S ribosomal protein L6 570 570 coexpression:570
Rv2843 hyp hypothetical protein 523 523 ctx neighborhood:521
Rv0716 rplE 50S ribosomal protein L5 521 521 coexpression:521

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Annotation from H37Rv (no MTBC0 1:1 anchor; H37Rv protein used): hypothetical protein
  • Pfam (hmmscan --cut_ga): YlxR PF04296.19 (E=3e-19)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_217356.3)
  • Domains: Pfam-A via hmmscan --cut_ga — YlxR (PF04296.19)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG2740
  • Curated reference: UniProt I6XFF7 (TrEMBL, unreviewed; Predicted)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 66 functional partner(s); context anchor nusA
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>H37Rv|Rv2840c|
MRTCVGCRKRGLAVELLRVVAVSTGNGNYAVIVDTATSLPGRGAWLHPLRQCAQQAIRRRAFARALRIAGSPDTSAVVEYLESLGELEPPGNRTGSNRT