Rv2827c Family assigned · medium auto-curated

H37Rv Rv2827c · MTBC0 mtbc0_003005 · 295 aa · 3155262–3156149 MTBC0 (-) · RefSeq NP_217343.1

Genomic neighbourhood (genome browser)

Open in full genome browser →
+ strand − strand cas2 (Rv2816c) — requalified: CRISPR-associated endonuclease Cas2 cas1 (Rv2817c) — requalified: CRISPR-associated endonuclease Cas1 cas1 csm5 (Rv2819c) — requalified: type III-A CRISPR-associated RAMP protein Csm5 csm5 csm4 (Rv2820c) — requalified: type III-A CRISPR-associated RAMP protein Csm4 csm4 csm3 (Rv2821c) — requalified: type III-A CRISPR-associated RAMP protein Csm3 csm2 (Rv2822c) — requalified: type III-A CRISPR-associated protein Csm2 cas10 (Rv2823c) — requalified: type III-A CRISPR-associated protein Cas10/Csm1 cas10 Rv2826c (Rv2826c) — family_assigned: nucleotidyl transferase AbiEii/AbiGii toxin family protein Rv2826c Rv2827c (Rv2827c) — family_assigned: type IV toxin-antitoxin system AbiEi family antitoxin Rv2827c Rv2828c (Rv2828c) — family_assigned: DUF1802 family protein vapC22 (Rv2829c) — family_assigned: PIN domain-containing protein vapB22 (Rv2830c) — family_assigned: type II toxin-antitoxin system prevent-host-death family ant echA16 (Rv2831) — requalified: enoyl-CoA hydratase ugpC (Rv2832c) — family_assigned: ABC transporter ATP-binding protein ugpC ugpB (Rv2833c) — family_assigned: ABC transporter substrate-binding protein ugpB ugpE (Rv2834c) — family_assigned: carbohydrate ABC transporter permease ugpE ugpA (Rv2835c) — family_assigned: sugar ABC transporter permease ugpA dinF (Rv2836c) — family_assigned: MATE family efflux transporter dinF nrnA (Rv2837c) — requalified: bifunctional oligoribonuclease/PAP phosphatase NrnA nrnA rbfA (Rv2838c) — requalified: 30S ribosome-binding factor RbfA infB (Rv2839c) — requalified: translation initiation factor IF-2 infB 3 144 kb 3 148 kb 3 152 kb 3 156 kb 3 160 kb 3 164 kb

This gene (outlined) in its genomic context; arrows are neighbouring genes coloured by verdict. Click any gene to navigate. Pan and zoom in the full browser.

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)hypothetical protein
MTBC0 PGAP re-annotationtype IV toxin-antitoxin system AbiEi family antitoxin
Revised (this work)Type IV toxin-antitoxin system AbiEi family antitoxin. Pfam: AbiEi_1 (PF09407.17).
Functional category (TubercuList)conserved hypotheticals

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

In the literature (TB corpus sweep) 3 publications

Found under: H37Rv (3).

3 TB publications mention this gene. 3 publication(s) mention this gene (title/abstract), verified against the text. The atlas states the function; these are the primary sources that discuss it.

PublicationDate
Antitoxin autoregulation of M. tuberculosis toxin-antitoxin expression through negative cooperativity arising from multiple inverted repeat sequences. doi:10.1042/BCJ20200368 2020
Structural analysis reveals DNA binding properties of Rv2827c, a hypothetical protein from Mycobacterium tuberculosis. doi:10.1007/s10969-009-9060-4 2009
Cloning, expression, purification, crystallization and preliminary X-ray diffraction analysis of Rv2827c from Mycobacterium tuberculosis. doi:10.1107/S1744309106024213 2006

This layer CITES the literature, it does not change the verdict or the function. A gene may be heavily studied (as an antigen, a resistance determinant, a drug target) while its molecular function is settled elsewhere in the fiche. This distinguishes a gene that is dark because nobody has looked from one that is dark despite having been studied. Source: PubMed (whole), MULTI-ALIAS sweep: H37Rv locus tag AND every ortholog identifier (M. bovis Mb…, M. marinum MMAR_…, M. smegmatis MSMEG_…, M. leprae ML…, M. abscessus MAB_…), each hit VERIFIED against the abstract text (word-boundary regex). phase73/phase75, 2026-07-13.

CRISPRi vulnerability

Vulnerability index -0.22 (95% CI -0.36 to -0.08). A more negative index = more vulnerable to knockdown (better drug-target quality); indicative threshold VI ≤ -6 = highly vulnerable.

Quantitative CRISPRi knockdown, graded (finer than binary Tn-seq essentiality). Source: CRISPRi vulnerability index (Bosch 2021, pebble.rockefeller.edu).

Legacy record & comparison (Mycobrowser) ahead of Mycobrowser

Mycobrowser classes this locus among conserved hypotheticals; the atlas now assigns a functional handle (COG category). Mycobrowser is no longer maintained, so its EC numbers predate recent nomenclature revisions (e.g. the 2018 EC 7 "translocase" class) — most EC differences are re-numberings of the same enzyme, not conflicts.

Orthologues (reciprocal best hits across mycobacteria)

M. bovis Mb2851c · 99.7% identity
M. orygis RJtmp_002914 · 99.7% identity

Reciprocal-best-hit orthologues (DIAMOND) against the Mycobrowser reference proteomes. A missing species is informative: e.g. a gene absent from M. leprae was likely lost in its reductive genome evolution. Locus tags link to Mycobrowser.

Curated reference (UniProt)

UniProt P71625 TrEMBL · unreviewed · Evidence at protein level
UniProt nameAbiEi antitoxin C-terminal domain-containing protein

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category K Transcription
eggNOG descriptionAbiEi antitoxin C-terminal domain
Orthologous groupCOG5340

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 1.524 · diversifying/relaxed
Polymorphic sites (≥ 0.1% of strains) 1 synonymous, 4 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Outgroup conservation (beyond the MTBC) Mycobacterium

M. canettii dN/dS (deep-divergence selection) 0.105 · 51 consensus substitution(s)
under purifying selection vs M. canettii (deep divergence; dN/dS=0.105) — a real, constrained gene predating the MTBC clonal expansion
Genus-wide presence (~53 non-MTBC Mycobacterium) present in 3/53 (6%) · mean identity 85.6% · 2/4 closest MTBAP relatives
present in a subset of the genus (3/53 NTM; in 2 of the 4 closest MTBAP relatives) — partial/intermediate conservation
Phylostratum (deepest detected homolog) MTBC-specific Mycobacterium Mycobacteriaceae Corynebacteriales Actinomycetia Bacteria

present across the genus Mycobacterium (NTM) but not detected in any non-Mycobacterium genome — a Mycobacterium-genus gene

Two orthogonal outgroup signals. M. canettii (the immediate outgroup) gives a deep-divergence dN/dS (a low value confirms a constrained, real gene; shown as confident only at ≥8 substitutions, else flagged low-power). Genus-wide presence/absence (tblastn vs assembled non-MTBC genomes) places the gene on the ancient-core ↔ MTBC-specific axis: a gene absent even from the closest MTBAP relatives is a candidate MTBC-specific innovation (possible host-adaptation factor, to confirm by synteny). The phylostratum extends that axis outside the genus (tblastn vs 13 reference genomes spanning Mycobacteriaceae → Corynebacteriales → Actinomycetia → outside the phylum): it is the deepest clade in which a homolog is still detected, i.e. a proxy for gene age. Read it with the null model in mind: a shallow (young) stratum can also reflect homology-detection failure for short or fast-evolving ORFs, so it is a descriptive axis, not a proof of novelty.

Essentiality (transposon mutagenesis) GD — not strictly essential

DeJesus 2017 callGD · growth-defect
What the call meansgrowth-defect: insertions tolerated but fitness reduced; NOT essential
TA sites (Himar1) 14 in the ORF — 0 in the essential state, 14 growth-defect, 0 non-essential, 0 growth-advantage. Saturation 0.357, mean read count 4.2. A region of the protein devoid of TA sites is invisible to this assay: nothing can be inferred about it, in either direction.
Caveat`essential: true` here is the broad union (ES+ESD+GD) kept for backward compatibility; this gene is NOT strictly essential. Read n_sites_* before writing anything about essentiality.

Genome-wide Himar1 transposon essentiality in H37Rv (DeJesus 2017). An essential call (ES/ESD/GD) is strong, independent evidence that a "hypothetical" locus encodes a functional, selectively required gene — orthogonal to intra-species conservation.

Proteomics (mass spectrometry) detected

MS detectiondetected in 7 of 16 independent MS datasets
Integrated abundance6.07 ppm · rank 2875/3519 (18.3th percentile)

Detection by mass spectrometry is direct, experimental evidence that the protein product exists — orthogonal to sequence conservation and to Tn-seq essentiality, and especially decisive for a "hypothetical" locus. Reproducible detection across several independent datasets (PaxDb) makes the existence claim robust; the integrated abundance places the protein in the proteome's dynamic range.

Physico-chemical properties (computed, ProtParam)

Length295 aa
Molecular weight32.3 kDa
Theoretical pI9.29
GRAVY-0.1 (hydrophilic)
Aliphatic index100.3
Aromaticity0.068
Instability index41.2 (unstable)

Computed from the ancestral MTBC0 sequence with the ExPASy ProtParam method (Biopython). Descriptive biophysical context: a positive GRAVY flags a hydrophobic (often membrane) protein, a high instability index (>40) predicts a short in-vitro half-life, an extreme pI hints at compartment or binding partner.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
AbiEi_1PF09407.17 2.8e-3997–236 AbiEi antitoxin C-terminal domain

Structural search (AlphaFold DB model, Foldseek vs PDB — genome-wide) pLDDT 96.0

PDB hitprobTM-scoreE-valueDescription
1zel-assembly1_A 1.00 0.98 8.2e-50 sig 1zel-assembly1_A Crystal structure of RV2827C protein from Mycobacterium tuberculosis

Foldseek search of the AlphaFold DB model (mean pLDDT 96.0, gated at 70) against the PDB — a genome-wide extension of the ESMFold dark-gene search that also covers proteins beyond the single-sequence length limit. Confident structural neighbours (E < 0.01) shown.

Genomic context (neighbours & predicted operon) operon of 2

Upstream (5' on genome)Rv2826c (- strand, 2 bp gap)
Downstream (3' on genome)Rv2828c (- strand, 304 bp gap)
Predicted operon Rv2826c · Rv2827c

Neighbours from the H37Rv annotation (- strand). The operon is predicted by co-directional intergenic distance (same strand, gaps ≤50 bp) — a transcription-unit hypothesis, not a mapped TSS. For a "hypothetical", co-transcription with a characterised operon is a concrete functional lead (complements the STRING neighborhood channel below).

Transcriptional regulation (signed TRN: ChIP-seq + TFOE) transcription factor

Regulated by (3 TF) Rv0081 (activates) · Rv2827c (activates) · lsr2 (activates)
Regulonthis transcription factor regulates 3 target gene(s)

Regulatory edges from the ISB signed transcriptional regulatory network (TF ChIP-seq binding, Minch 2015 + TF-overexpression response, Rustad 2014). An edge is regulatory evidence (binding and/or expression change), not necessarily direct. For a "hypothetical", membership in a known regulon (e.g. DosR dormancy, PhoP virulence) is a strong physiological-context lead.

Functional interaction network (STRING v12, guilt-by-association)

Explore full network →

Node colour = verdict, dashed = hypothetical; edge colour = evidence (green experimental, orange genomic-context, grey co-expression), width ∝ score. Click a partner to open its page; "Explore full network" to walk the graph.

PartnerProductScoreNo text-miningChannels (≥400)
Rv2826c hyp hypothetical protein 990 884 ctx neighborhood:882 textmining:924
Rv3183 higA3 transcriptional regulator 617 617 coexpression:615
Rv3060c GntR family transcriptional regulator 533 533 coexpression:533
Rv2825c hyp hypothetical protein 493 492 ctx neighborhood:480
Rv2828c hyp hypothetical protein 432 432 ctx neighborhood:421
Rv2828A hyp hypothetical protein 424 424 ctx neighborhood:424
Rv2829c vapC22 ribonuclease VapC22 434 417
Rv2830c vapB22 antitoxin VapB22 401 401
Rv1045 hyp hypothetical protein 877 98 textmining:870
Rv0909 antitoxin 526 55 textmining:519
Rv0837c hyp hypothetical protein 807 54 textmining:805
Rv0078A hyp hypothetical protein 806 50 textmining:805
Rv0836c hyp hypothetical protein 870 49 textmining:869
Rv1044 hyp hypothetical protein 870 47 textmining:870
Rv1545 hyp hypothetical protein 529 47 textmining:527

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The exp badge marks an experimentally-supported partner (measured interaction, experimental/database channel ≥400) as opposed to a purely predicted one — but note that the M. tuberculosis experimental interactome is dominated by a noisy bacterial-two-hybrid screen, so a strong measured link that contradicts the operon/localisation context is likely a false positive. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: hypothetical protein
  • MTBC0 PGAP product: type IV toxin-antitoxin system AbiEi family antitoxin
  • Pfam (hmmscan --cut_ga): AbiEi_1 PF09407.17 (E=3e-39)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_217343.1)
  • Domains: Pfam-A via hmmscan --cut_ga — AbiEi_1 (PF09407.17)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG5340
  • Curated reference: UniProt P71625 (TrEMBL, unreviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Genome-wide structure: AlphaFold DB model (Jumper et al. 2021, doi:10.1038/s41586-021-03819-2; Varadi et al. 2024, doi:10.1093/nar/gkad1011) searched vs PDB with Foldseek (mean pLDDT 96.0)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 23 functional partner(s)
  • Essentiality: genome-wide transposon mutagenesis in H37Rv — DeJesus et al. 2017 (mBio, doi:10.1128/mBio.02133-16, CC BY)
  • Proteomics: integrated mass-spectrometry abundance from PaxDb 5.0 (Huang et al. 2023, doi:10.1016/j.mcpro.2023.100640), taxon 83332 — weighted average of 16 datasets, incl. Schubert et al. 2013 (doi:10.1016/j.chom.2013.04.008) and Albrethsen et al. 2013 (doi:10.1074/mcp.M112.018846)
  • Functional category: TubercuList scheme (Cole et al. 1998, doi:10.1038/31159), via Mycobrowser (Kapopoulou et al. 2011, doi:10.1016/j.tube.2010.09.006)
  • Orthologues: reciprocal best hits (DIAMOND, Buchfink et al. 2021, doi:10.1038/s41592-021-01101-x) against Mycobrowser release 5 reference proteomes
  • Genomic context / operon: H37Rv annotation; operon predicted by co-directional intergenic distance (Salgado et al. 2000, doi:10.1073/pnas.030539397)
  • Transcriptional regulation: ISB signed TRN — TF ChIP-seq (Minch et al. 2015, doi:10.1038/ncomms6829) + TF overexpression (Rustad et al. 2014, doi:10.1186/gb-2014-15-11-502)
  • Physico-chemical properties: ExPASy ProtParam method via Biopython (Gasteiger et al. 2005), computed from the MTBC0 sequence
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_003005|Rv2827c|
MVSPAGADRRIPTWASRVVSGLARDRPVVVTKEDLTQRLTEAGCGRDPDSAIRELRRIGWLVQLPVKGTWAFIPPGEAAISDPYLPLRSWLARDQNAGFMLAGASAAWHLGYLDRQPDGRIPIWLPPAKRLPDGLASYVSVVRIPWNAADTALLAPRPALLVRRRLDLVAWATGLPALGPEALLVQIATRPASFGPWADLVPHLDDLVADCSDERLERLLSGRPTSAWQRASYLLDSGGEPARGQALLAKRHTEVMPVTRFTTAHSRDRGESVWAPEYQLVDELVVPLLRVIGKA