pdxH Resolved · high auto-curated

H37Rv Rv2607 · MTBC0 mtbc0_002775 · 224 aa · 2957751–2958425 (+) · RefSeq NP_217123.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)pyridoxine/pyridoxamine 5'-phosphate oxidase
MTBC0 PGAP re-annotationpyridoxamine 5'-phosphate oxidase
Revised (this work)Pyridoxamine 5'-phosphate oxidase. Pfam: PNPOx_N (PF01243.28), PNP_phzG_C (PF10590.15).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt P9WIJ1 SwissProt · reviewed · Evidence at protein level
UniProt namePyridoxine 5'-phosphate oxidase
EC (curated) EC 1.4.3.5
Curated functionCatalyzes the oxidation of pyridoxine 5'-phosphate (PNP) into pyridoxal 5'-phosphate (PLP). Unlike many PNPOx enzymes, Rv2607 does not recognize pyridoxamine 5'-phosphate (PMP) as a substrate.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category H Coenzyme transport and metabolism
Preferred namepdxH
eggNOG descriptionCatalyzes the oxidation of either pyridoxine 5'- phosphate (PNP) or pyridoxamine 5'-phosphate (PMP) into pyridoxal 5'-phosphate (PLP)
Orthologous groupCOG0259
EC number EC 1.4.3.5
KEGG orthology K00275
KEGG pathways map00750, map01100, map01120
KEGG modules M00124
Gene Ontology (67) GO:0000166, GO:0003674, GO:0003824, GO:0005488, GO:0005515, GO:0006081, GO:0006725, GO:0006732, GO:0006766, GO:0006767, GO:0006793, GO:0006796 +55 more

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.308 · purifying
Polymorphic sites (≥ 0.1% of strains) 2 synonymous, 2 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
PNPOx_NPF01243.28 2.7e-2050–172 Pyridoxamine 5'-phosphate oxidase
PNP_phzG_CPF10590.15 1.1e-13188–224 Pyridoxine 5'-phosphate oxidase C-terminal dimerisation region

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: snzP (pyridoxine biosynthesis protein), high confidence from genomic context alone (score 953 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv2606c snzP pyridoxine biosynthesis protein 988 953 ctx neighborhood:550 database:900 textmining:757
Rv2604c snoP glutamine amidotransferase SnoP 994 947 ctx neighborhood:496 database:900 textmining:898
Rv1380 pyrB aspartate carbamoyltransferase 583 567 ctx fusion:539
Rv0896 gltA2 citrate synthase 1 570 551 ctx neighborhood:544
Rv0889c citA citrate synthase 2 568 548 ctx neighborhood:544
Rv0887c hyp hypothetical protein 545 546 ctx neighborhood:544
Rv2605c tesB2 acyl-CoA thioesterase II 499 499 ctx neighborhood:496
Rv2608 PPE42 PPE family protein PPE42 491 491 ctx neighborhood:488
Rv0038 hyp hypothetical protein 438 438
Rv1384 carB carbamoyl-phosphate synthase large subunit 462 415 ctx fusion:401
Rv1248c kgd multifunctional 2-oxoglutarate dehydrogenase E1 component /2-oxoglutarate dehydrogenase dihydrolipoyllysine-residue succinyltransferase 436 355
Rv1832 gcvB glycine dehydrogenase 524 328
Rv2139 pyrD dihydroorotate dehydrogenase 445 274
Rv0121c hyp hypothetical protein 817 73 textmining:811
Rv1875 hyp hypothetical protein 572 69 textmining:559

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: pyridoxine/pyridoxamine 5'-phosphate oxidase
  • MTBC0 PGAP product: pyridoxamine 5'-phosphate oxidase
  • Pfam (hmmscan --cut_ga): PNPOx_N PF01243.28 (E=3e-20), PNP_phzG_C PF10590.15 (E=1e-13)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_217123.1)
  • Domains: Pfam-A via hmmscan --cut_ga — PNPOx_N (PF01243.28), PNP_phzG_C (PF10590.15)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG0259
  • Curated reference: UniProt P9WIJ1 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 28 functional partner(s); context anchor snzP
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_002775|Rv2607|pdxH
MDDDAQMVAIDKDQLARMRGEYGPEKDGCGDLDFDWLDDGWLTLLRRWLNDAQRAGVSEPNAMVLATVADGKPVTRSVLCKILDESGVAFFTSYTSAKGEQLAVTPYASATFPWYQLGRQAHVQGPVSKVSTEEIFTYWSMRPRGAQLGAWASQQSRPVGSRAQLDNQLAEVTRRFADQDQIPVPPGWGGYRIAPEIVEFWQGRENRMHNRIRVANGRLERLQP