vapB40 Family assigned · medium auto-curated
H37Rv Rv2595 · MTBC0 mtbc0_002762 ·
81 aa · 2949045–2949290 (+) ·
RefSeq NP_217111.1
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | antitoxin VapB40 |
|---|---|
| MTBC0 PGAP re-annotation | AbrB/MazE/SpoVT family DNA-binding domain-containing protein |
| Revised (this work) | AbrB/MazE/SpoVT family DNA-binding domain-containing protein. Pfam: MazE_antitoxin (PF04014.24). |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
Curated reference (UniProt)
| UniProt |
P9WFC3
SwissProt · reviewed
· Evidence at protein level
|
|---|---|
| UniProt name | Antitoxin VapB40 |
| Curated function | Antitoxin component of a type II toxin-antitoxin (TA) system. Its cognate toxin is VapC40. Upon expression in E.coli partially counteracts the ribonuclease activity of non-cognate toxins MazF6 and MazF9. |
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
K Transcription
|
|---|---|
| eggNOG description | toxin-antitoxin pair type II binding |
| Orthologous group | COG2002 |
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS | 0.769 · relaxed/neutral |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 1 synonymous, 2 missense, 0 nonsense, 1 frameshift |
| Disruption | 1 distinct premature-stop/frameshift site(s); most common in 0.34% of strains (497) · clonal |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
MazE_antitoxin | PF04014.24 | 6.3e-09 | 9–44 | Antidote-toxin recognition MazE, bacterial antitoxin |
Functional interaction network (STRING v12, guilt-by-association)
Closest characterised functional partner: vapC40 (ribonuclease VapC40), high confidence from genomic context alone (score 883 excluding text-mining).
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv2596 vapC40 |
ribonuclease VapC40 | 883 | 883 ctx | neighborhood:882 |
Rv2597 |
membrane protein | 590 | 590 ctx | neighborhood:590 |
Rv2598 hyp |
hypothetical protein | 584 | 584 ctx | neighborhood:584 |
Rv2593c ruvA |
Holliday junction ATP-dependent DNA helicase RuvA | 554 | 555 ctx | neighborhood:552 |
Rv2594c ruvC |
crossover junction endodeoxyribonuclease RuvC | 554 | 555 ctx | neighborhood:552 |
Rv2592c ruvB |
Holliday junction ATP-dependent DNA helicase RuvB | 553 | 554 ctx | neighborhood:552 |
Rv2599 |
membrane protein | 544 | 544 ctx | neighborhood:544 |
Rv2601 speE |
spermidine synthase | 410 | 410 ctx | neighborhood:410 |
Rv0599c vapB27 |
antitoxin VapB27 | 658 | 55 | textmining:653 |
Rv0456B mazE1 |
antitoxin MazE1 | 653 | 41 | textmining:653 |
Rv1991A mazE6 |
antitoxin MazE6 | 518 | 41 | textmining:518 |
Rv2801A mazE9 |
antitoxin MazE9 | 514 | 41 | textmining:514 |
Rv2801c mazF9 |
mRNA interferase MazF9 | 513 | 41 | textmining:513 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Legacy H37Rv annotation: antitoxin VapB40
- MTBC0 PGAP product: AbrB/MazE/SpoVT family DNA-binding domain-containing protein
- Pfam (hmmscan --cut_ga): MazE_antitoxin PF04014.24 (E=6e-09)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_217111.1)
- Domains: Pfam-A via hmmscan --cut_ga — MazE_antitoxin (PF04014.24)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
COG2002 - Curated reference: UniProt P9WFC3 (SwissProt, reviewed; Evidence at protein level)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
13 functional partner(s); context anchor
vapC40 - Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>mtbc0_002762|Rv2595|vapB40 MRTTIDVAGRLVIPKRIRERLGLRGNDQVEITERDGRIEIEPAPTGVELVREGSVLVARPERPLPPLTDEIVRETLDRTRR