vapB40 Family assigned · medium auto-curated

H37Rv Rv2595 · MTBC0 mtbc0_002762 · 81 aa · 2949045–2949290 (+) · RefSeq NP_217111.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)antitoxin VapB40
MTBC0 PGAP re-annotationAbrB/MazE/SpoVT family DNA-binding domain-containing protein
Revised (this work)AbrB/MazE/SpoVT family DNA-binding domain-containing protein. Pfam: MazE_antitoxin (PF04014.24).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt P9WFC3 SwissProt · reviewed · Evidence at protein level
UniProt nameAntitoxin VapB40
Curated functionAntitoxin component of a type II toxin-antitoxin (TA) system. Its cognate toxin is VapC40. Upon expression in E.coli partially counteracts the ribonuclease activity of non-cognate toxins MazF6 and MazF9.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category K Transcription
eggNOG descriptiontoxin-antitoxin pair type II binding
Orthologous groupCOG2002

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.769 · relaxed/neutral
Polymorphic sites (≥ 0.1% of strains) 1 synonymous, 2 missense, 0 nonsense, 1 frameshift
Disruption 1 distinct premature-stop/frameshift site(s); most common in 0.34% of strains (497) · clonal

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
MazE_antitoxinPF04014.24 6.3e-099–44 Antidote-toxin recognition MazE, bacterial antitoxin

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: vapC40 (ribonuclease VapC40), high confidence from genomic context alone (score 883 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv2596 vapC40 ribonuclease VapC40 883 883 ctx neighborhood:882
Rv2597 membrane protein 590 590 ctx neighborhood:590
Rv2598 hyp hypothetical protein 584 584 ctx neighborhood:584
Rv2593c ruvA Holliday junction ATP-dependent DNA helicase RuvA 554 555 ctx neighborhood:552
Rv2594c ruvC crossover junction endodeoxyribonuclease RuvC 554 555 ctx neighborhood:552
Rv2592c ruvB Holliday junction ATP-dependent DNA helicase RuvB 553 554 ctx neighborhood:552
Rv2599 membrane protein 544 544 ctx neighborhood:544
Rv2601 speE spermidine synthase 410 410 ctx neighborhood:410
Rv0599c vapB27 antitoxin VapB27 658 55 textmining:653
Rv0456B mazE1 antitoxin MazE1 653 41 textmining:653
Rv1991A mazE6 antitoxin MazE6 518 41 textmining:518
Rv2801A mazE9 antitoxin MazE9 514 41 textmining:514
Rv2801c mazF9 mRNA interferase MazF9 513 41 textmining:513

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: antitoxin VapB40
  • MTBC0 PGAP product: AbrB/MazE/SpoVT family DNA-binding domain-containing protein
  • Pfam (hmmscan --cut_ga): MazE_antitoxin PF04014.24 (E=6e-09)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_217111.1)
  • Domains: Pfam-A via hmmscan --cut_ga — MazE_antitoxin (PF04014.24)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG2002
  • Curated reference: UniProt P9WFC3 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 13 functional partner(s); context anchor vapC40
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_002762|Rv2595|vapB40
MRTTIDVAGRLVIPKRIRERLGLRGNDQVEITERDGRIEIEPAPTGVELVREGSVLVARPERPLPPLTDEIVRETLDRTRR