kdtB Resolved · high auto-curated

H37Rv Rv2965c · MTBC0 mtbc0_003149 · 161 aa · 3339505–3339990 (-) · RefSeq NP_217481.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)phosphopantetheine adenylyltransferase
MTBC0 PGAP re-annotationpantetheine-phosphate adenylyltransferase
Revised (this work)Pantetheine-phosphate adenylyltransferase. Pfam: CTP_transf_like (PF01467.33), Citrate_ly_lig (PF08218.18).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt P9WPA5 SwissProt · reviewed · Evidence at protein level
UniProt namePhosphopantetheine adenylyltransferase
EC (curated) EC 2.7.7.3
Curated functionReversibly transfers an adenylyl group from ATP to 4'-phosphopantetheine, yielding dephospho-CoA (dPCoA) and pyrophosphate.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category F Nucleotide transport and metabolism
Preferred namecoaD
eggNOG descriptionReversibly transfers an adenylyl group from ATP to 4'- phosphopantetheine, yielding dephospho-CoA (dPCoA) and pyrophosphate
Orthologous groupCOG0669
EC number EC 2.7.7.3
KEGG orthology K00954
KEGG pathways map00770, map01100
KEGG modules M00120
Gene Ontology (71) GO:0003674, GO:0003824, GO:0004595, GO:0006139, GO:0006163, GO:0006164, GO:0006725, GO:0006732, GO:0006753, GO:0006793, GO:0006796, GO:0006807 +59 more

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.0 · strong purifying
Polymorphic sites (≥ 0.1% of strains) 1 synonymous, 0 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
CTP_transf_likePF01467.33 1.0e-245–132 Cytidylyltransferase-like
Citrate_ly_ligPF08218.18 5.4e-0711–74 Citrate lyase ligase C-terminal domain

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: rsmD (methyltransferase), high confidence from genomic context alone (score 923 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv1391 dfp bifunctional phosphopantothenoylcysteine decarboxylase/phosphopantothenate--cysteine ligase 994 930 database:900 textmining:930
Rv2966c rsmD methyltransferase 953 923 ctx neighborhood:636 coexpression:682 textmining:422
Rv3600c coaX type III pantothenate kinase 950 919 database:900 textmining:416
Rv1631 coaE dephospho-CoA kinase CoaE 994 911 database:900 textmining:938
Rv1092c coaA pantothenate kinase 959 900 database:900 textmining:614
Rv2786c ribF bifunctional riboflavin kinase /FMN adenylyltransferase 840 611 ctx cooccurence:594 textmining:608
Rv1712 cmk cytidylate kinase 553 554 ctx cooccurence:412
Rv3100c smpB SsrA-binding protein 495 496
Rv2967c pca pyruvate carboxylase 528 489 ctx neighborhood:466
Rv1107c xseB exodeoxyribonuclease VII small subunit 470 470 coexpression:426
Rv1392 metK S-adenosylmethionine synthetase 570 465 ctx cooccurence:463
Rv0321 dcd deoxycytidine triphosphate deaminase 455 456 coexpression:456
Rv3396c guaA GMP synthase 718 444 textmining:514
Rv2611c phosphatidylinositol mannoside acyltransferase 442 442 coexpression:418
Rv3781 rfbE O-antigen/lipopolysaccharide ABC transporter ATP-binding protein RfbE 410 411 coexpression:404

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: phosphopantetheine adenylyltransferase
  • MTBC0 PGAP product: pantetheine-phosphate adenylyltransferase
  • Pfam (hmmscan --cut_ga): CTP_transf_like PF01467.33 (E=1e-24), Citrate_ly_lig PF08218.18 (E=5e-07)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_217481.1)
  • Domains: Pfam-A via hmmscan --cut_ga — CTP_transf_like (PF01467.33), Citrate_ly_lig (PF08218.18)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG0669
  • Curated reference: UniProt P9WPA5 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 54 functional partner(s); context anchor rsmD
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_003149|Rv2965c|kdtB
MTGAVCPGSFDPVTLGHVDIFERAAAQFDEVVVAILVNPAKTGMFDLDERIAMVKESTTHLPNLRVQVGHGLVVDFVRSCGMTAIVKGLRTGTDFEYELQMAQMNKHIAGVDTFFVATAPRYSFVSSSLAKEVAMLGGDVSELLPEPVNRRLRDRLNTERT