Rv2597 Still unknown · low auto-curated

H37Rv Rv2597 · MTBC0 mtbc0_002764 · 206 aa · 2949908–2950528 (+) · RefSeq NP_217113.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)membrane protein
MTBC0 PGAP re-annotationDUF4178 domain-containing protein
Revised (this work)Conserved hypothetical protein; DUF domain(s) DUF4178. Function unknown.

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt P9WL73 SwissProt · reviewed · Evidence at protein level
UniProt nameUncharacterized protein Rv2597

UniProt still lists this protein as Uncharacterized protein Rv2597; the revised annotation above is ahead of the current UniProt record.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category S Function unknown
eggNOG descriptionDomain of unknown function (DUF4178)
Orthologous group2A0M8

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.347 · purifying
Polymorphic sites (≥ 0.1% of strains) 2 synonymous, 2 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
DUF4178PF13785.12 6.0e-3354–191 Domain of unknown function (DUF4178)

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: Rv2600 (integral membrane protein), high confidence from genomic context alone (score 946 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv2598 hyp hypothetical protein 976 977 ctx neighborhood:874 cooccurence:773
Rv2600 integral membrane protein 946 946 ctx neighborhood:778 cooccurence:763
Rv2601 speE spermidine synthase 905 906 ctx neighborhood:629 cooccurence:753
Rv2599 membrane protein 875 876 ctx neighborhood:874
Rv1006 hyp hypothetical protein 702 703 ctx cooccurence:701
Rv1868 hyp hypothetical protein 685 685 ctx cooccurence:685
Rv1435c hyp hypothetical protein 640 640 ctx cooccurence:640
Rv2047c hyp hypothetical protein 597 597 ctx cooccurence:597
Rv2596 vapC40 ribonuclease VapC40 590 590 ctx neighborhood:590
Rv2595 vapB40 antitoxin VapB40 590 590 ctx neighborhood:590
Rv3033 hyp hypothetical protein 558 559 ctx cooccurence:558
Rv2571c transmembrane protein 446 447 ctx cooccurence:444
Rv3134c universal stress protein 446 446 ctx cooccurence:446
Rv3060c GntR family transcriptional regulator 443 443 ctx cooccurence:443
Rv0180c transmembrane protein 440 441 ctx cooccurence:405

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: membrane protein
  • MTBC0 PGAP product: DUF4178 domain-containing protein
  • Pfam (hmmscan --cut_ga): DUF4178 PF13785.12 (E=6e-33)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_217113.1)
  • Domains: Pfam-A via hmmscan --cut_ga — DUF4178 (PF13785.12)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG 2A0M8
  • Curated reference: UniProt P9WL73 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 21 functional partner(s); context anchor Rv2600
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_002764|Rv2597|
MGNLLVVIAVALFIAAIVVLVVAIRRPKTPATPGGRRDPLAFDAMPQFGPRQLGPGAIVSHGGIDYVVRGSVTFREGPFVWWEHLLEGGDTPTWLSVQEDDGRLELAMWVKRTDLGLQPGGQHVIDGVTFQETERGHAGYTTEGTTGLPAGGEMDYVDCASAGQGADESMLLSFERWAPDMGWEIATGKSVLAGELTVYPAPPVSA