Rv2898c Family assigned · low auto-curated

H37Rv Rv2898c · MTBC0 mtbc0_003080 · 128 aa · 3228771–3229157 MTBC0 (-) · RefSeq NP_217414.1

Genomic neighbourhood (genome browser)

Open in full genome browser →
+ strand − strand Rv2887 (Rv2887) — family_assigned: MarR family transcriptional regulator amiC (Rv2888c) — requalified: amidase amiC tsf (Rv2889c) — requalified: translation elongation factor Ts rpsB (Rv2890c) — requalified: 30S ribosomal protein S2 rpsB Rv2893 (Rv2893) — requalified: LLM class F420-dependent oxidoreductase Rv2893 xerC (Rv2894c) — requalified: tyrosine recombinase XerC xerC viuB (Rv2895c) — requalified: siderophore-interacting protein viuB dprA (Rv2896c) — requalified: DNA-processing protein DprA dprA Rv2897c (Rv2897c) — family_assigned: YifB family Mg chelatase-like AAA ATPase Rv2897c Rv2898c (Rv2898c) — family_assigned: YraN family protein fdhD (Rv2899c) — requalified: formate dehydrogenase accessory sulfurtransferase FdhD fdhD fdhF (Rv2900c) — family_assigned: FdhF/YdeP family oxidoreductase fdhF Rv2901c (Rv2901c) — dark: DUF2469 domain-containing protein rnhB (Rv2902c) — requalified: ribonuclease HII lepB (Rv2903c) — requalified: signal peptidase I lepB rplS (Rv2904c) — requalified: 50S ribosomal protein L19 lppW (Rv2905) — family_assigned: hypothetical protein lppW trmD (Rv2906c) — requalified: tRNA (guanosine(37)-N1)-methyltransferase TrmD rimM (Rv2907c) — requalified: ribosome maturation factor RimM Rv2908c (Rv2908c) — family_assigned: RNA-binding protein rpsP (Rv2909c) — requalified: 30S ribosomal protein S16 Rv2912c (Rv2912c) — family_assigned: TetR/AcrR family transcriptional regulator Rv2913c (Rv2913c) — family_assigned: amidohydrolase family protein 3 220 kb 3 224 kb 3 228 kb 3 232 kb 3 236 kb 3 240 kb

This gene (outlined) in its genomic context; arrows are neighbouring genes coloured by verdict. Click any gene to navigate. Pan and zoom in the full browser.

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)hypothetical protein
MTBC0 PGAP re-annotationYraN family protein
Revised (this work)YraN family protein.
Functional category (TubercuList)conserved hypotheticals

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

In the literature (TB corpus sweep) never studied

No publication in PubMed mentions this gene in its title or abstract — not under its H37Rv locus tag, nor under any of its ortholog identifiers (M. bovis, M. marinum, M. smegmatis, M. leprae, M. abscessus). The atlas annotation rests on sequence/structure evidence, not on a primary study of this gene.

A verified absence of literature is itself information: it flags an annotation with no primary study behind it. This distinguishes a gene that is dark because nobody has looked from one that is dark despite having been studied. Source: PubMed (whole), MULTI-ALIAS sweep: H37Rv locus tag AND every ortholog identifier (M. bovis Mb…, M. marinum MMAR_…, M. smegmatis MSMEG_…, M. leprae ML…, M. abscessus MAB_…), each hit VERIFIED against the abstract text (word-boundary regex). phase73/phase75, 2026-07-13.

Genomic-neighbour overlap (structural caveat) co-directional · 0 % of gene

NeighbourcomM (Rv2897c, - strand)
Overlap1 bp, 0 % of this gene's length

co-directional overlap: ordinary (e.g. shared stop/start codons in an operon), not the Rv2438A-type artefact P20.1, derived from GFF3 gene coordinates, 2026-08-03.

Legacy record & comparison (Mycobrowser) ahead of Mycobrowser

Mycobrowser functionFunction unknown

Mycobrowser classes this locus among conserved hypotheticals; the atlas now assigns a functional handle (COG category). Mycobrowser is no longer maintained, so its EC numbers predate recent nomenclature revisions (e.g. the 2018 EC 7 "translocase" class) — most EC differences are re-numberings of the same enzyme, not conflicts.

Orthologues (reciprocal best hits across mycobacteria)

M. bovis Mb2922c · 100.0% identity
M. leprae ML1607c · 58.3% identity
M. marinum MMAR_1812 · 75.2% identity
M. smegmatis MSMEG_2508 · 64.8% identity
M. orygis RJtmp_002989 · 100.0% identity
M. abscessus MAB_3214c · 56.6% identity

Reciprocal-best-hit orthologues (DIAMOND) against the Mycobrowser reference proteomes. A missing species is informative: e.g. a gene absent from M. leprae was likely lost in its reductive genome evolution. Locus tags link to Mycobrowser.

Curated reference (UniProt)

UniProt P9WFM9 SwissProt · reviewed · Inferred from homology
UniProt nameUPF0102 protein Rv2898c

UniProt still lists this protein as UPF0102 protein Rv2898c; the revised annotation above is ahead of the current UniProt record.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category L Replication, recombination and repair
Preferred nameyraN
eggNOG descriptionBelongs to the UPF0102 family
Orthologous groupCOG0792
KEGG orthology K07460

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS n/a
Polymorphic sites (≥ 0.1% of strains) 0 synonymous, 1 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Outgroup conservation (beyond the MTBC) Bacteria

Genus-wide presence (~53 non-MTBC Mycobacterium) present in 53/53 (100%) · mean identity 77.4% · 4/4 closest MTBAP relatives
conserved across the genus (present in 53/53 non-MTBC Mycobacterium genomes, incl. distant relatives) — an ancient core gene predating the genus radiation
Phylostratum (deepest detected homolog) MTBC-specific Mycobacterium Mycobacteriaceae Corynebacteriales Actinomycetia Bacteria
detected in 10/13 non-Mycobacterium reference genomes (down to Bacteria) · mean identity 46.2%
detected down to outside the phylum (Proteobacteria/Firmicutes controls) — a universally conserved, ancient bacterial gene

Two orthogonal outgroup signals. M. canettii (the immediate outgroup) gives a deep-divergence dN/dS (a low value confirms a constrained, real gene; shown as confident only at ≥8 substitutions, else flagged low-power). Genus-wide presence/absence (tblastn vs assembled non-MTBC genomes) places the gene on the ancient-core ↔ MTBC-specific axis: a gene absent even from the closest MTBAP relatives is a candidate MTBC-specific innovation (possible host-adaptation factor, to confirm by synteny). The phylostratum extends that axis outside the genus (tblastn vs 13 reference genomes spanning Mycobacteriaceae → Corynebacteriales → Actinomycetia → outside the phylum): it is the deepest clade in which a homolog is still detected, i.e. a proxy for gene age. Read it with the null model in mind: a shallow (young) stratum can also reflect homology-detection failure for short or fast-evolving ORFs, so it is a descriptive axis, not a proof of novelty.

Essentiality (transposon mutagenesis)

DeJesus 2017 callNE · non-essential
What the call meansnon-essential
TA sites (Himar1) 4 in the ORF — 0 in the essential state, 0 growth-defect, 4 non-essential, 0 growth-advantage. Saturation 1.000, mean read count 41.5. A region of the protein devoid of TA sites is invisible to this assay: nothing can be inferred about it, in either direction.
CaveatStatistically thin call: only 4 TA (Himar1) sites in the whole ORF (atlas median 13; genes under 300 nt typically have very few). A DeJesus 2017 call built on so few independent observations is less robust than the same call on a longer gene, in either direction. Cross-check against the CRISPRi vulnerability index (independent of TA-site density) and, if this gene overlaps a neighbour (see Genomic-neighbour overlap section below), verify how many of its TA sites actually fall inside its own ORF. (P20.3)

Genome-wide Himar1 transposon essentiality in H37Rv (DeJesus 2017). An essential call (ES/ESD/GD) is strong, independent evidence that a "hypothetical" locus encodes a functional, selectively required gene — orthogonal to intra-species conservation.

Proteomics (mass spectrometry) detected

MS detectiondetected in 1 of 16 independent MS datasets
Integrated abundance0.1 ppm · rank 3473/3519 (1.3th percentile)

Detection by mass spectrometry is direct, experimental evidence that the protein product exists — orthogonal to sequence conservation and to Tn-seq essentiality, and especially decisive for a "hypothetical" locus. Reproducible detection across several independent datasets (PaxDb) makes the existence claim robust; the integrated abundance places the protein in the proteome's dynamic range.

Physico-chemical properties (computed, ProtParam)

Length128 aa
Molecular weight14.2 kDa
Theoretical pI10.11
GRAVY-0.145 (hydrophilic)
Aliphatic index96.7
Aromaticity0.055
Instability index33.4 (stable)

Computed from the ancestral MTBC0 sequence with the ExPASy ProtParam method (Biopython). Descriptive biophysical context: a positive GRAVY flags a hydrophobic (often membrane) protein, a high instability index (>40) predicts a short in-vitro half-life, an extreme pI hints at compartment or binding partner.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
UPF0102PF02021.24 1.8e-2816–108 Uncharacterised protein family UPF0102

Structural search (AlphaFold DB model, Foldseek vs PDB — genome-wide) pLDDT 89.7

PDB hitprobTM-scoreE-valueDescription
3fov-assembly1_A 1.00 0.76 1.8e-08 sig 3fov-assembly1_A Crystal structure of protein RPA0323 of unknown function from Rhodopseudomonas palustris
5gkh-assembly1_B 0.90 0.46 9.9e-03 sig 5gkh-assembly1_B Structure of EndoMS-dsDNA2 complex
3ebc-assembly1_B 0.75 0.43 8.6e-03 sig 3ebc-assembly1_B Structure of N141A HincII with Cognate DNA
4da2-assembly1_A 0.66 0.33 6.6e-03 sig 4da2-assembly1_A The structure of Pyrococcus Furiosus SfsA in complex with Ca2+

Foldseek search of the AlphaFold DB model (mean pLDDT 89.7, gated at 70) against the PDB — a genome-wide extension of the ESMFold dark-gene search that also covers proteins beyond the single-sequence length limit. Confident structural neighbours (E < 0.01) shown.

Genomic context (neighbours & predicted operon) operon of 4

Upstream (5' on genome)Rv2897c (- strand, -1 bp gap)
Downstream (3' on genome)fdhD (- strand, 247 bp gap)
Predicted operon viuB · Rv2896c · Rv2897c · Rv2898c

Neighbours from the H37Rv annotation (- strand). The operon is predicted by co-directional intergenic distance (same strand, gaps ≤50 bp) — a transcription-unit hypothesis, not a mapped TSS. For a "hypothetical", co-transcription with a characterised operon is a concrete functional lead (complements the STRING neighborhood channel below).

Functional interaction network (STRING v12, guilt-by-association)

Explore full network →

Node colour = verdict, dashed = hypothetical; edge colour = evidence (green experimental, orange genomic-context, grey co-expression), width ∝ score. Click a partner to open its page; "Explore full network" to walk the graph.

Closest characterised functional partner: viuB (mycobactin utilization protein ViuB), high confidence from genomic context alone (score 837 excluding text-mining). This association is the citable seed of a function hypothesis for this hypothetical protein.

PartnerProductScoreNo text-miningChannels (≥400)
Rv2897c hyp hypothetical protein 965 963 ctx neighborhood:882 cooccurence:676
Rv2896c dprA hyp hypothetical protein 938 939 ctx neighborhood:882
Rv2895c viuB mycobactin utilization protein ViuB 837 837 ctx neighborhood:836
Rv2899c fdhD formate dehydrogenase accessory protein FdhD 729 729 ctx neighborhood:726
Rv1364c sigma factor regulatory protein 677 678 coexpression:667
Rv1354c hyp hypothetical protein 639 640 coexpression:628
Rv2594c ruvC crossover junction endodeoxyribonuclease RuvC 606 606 ctx cooccurence:592
Rv2894c xerC tyrosine recombinase XerC 599 600 ctx neighborhood:598
Rv2900c fdhF formate dehydrogenase subunit alpha FdhF 577 576 ctx neighborhood:570
Rv2903c lepB signal peptidase 497 497
Rv2901c hyp hypothetical protein 479 480 ctx neighborhood:473
Rv2414c hyp hypothetical protein 475 475
Rv2904c rplS 50S ribosomal protein L19 471 471
Rv2926c hyp hypothetical protein 463 463 ctx cooccurence:446
Rv2902c rnhB ribonuclease HII 438 438 ctx neighborhood:430

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The exp badge marks an experimentally-supported partner (measured interaction, experimental/database channel ≥400) as opposed to a purely predicted one — but note that the M. tuberculosis experimental interactome is dominated by a noisy bacterial-two-hybrid screen, so a strong measured link that contradicts the operon/localisation context is likely a false positive. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: hypothetical protein
  • MTBC0 PGAP product: YraN family protein
  • Pfam (hmmscan --cut_ga): UPF0102 PF02021.24 (E=2e-28)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_217414.1)
  • Domains: Pfam-A via hmmscan --cut_ga — UPF0102 (PF02021.24)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG0792
  • Curated reference: UniProt P9WFM9 (SwissProt, reviewed; Inferred from homology)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Genome-wide structure: AlphaFold DB model (Jumper et al. 2021, doi:10.1038/s41586-021-03819-2; Varadi et al. 2024, doi:10.1093/nar/gkad1011) searched vs PDB with Foldseek (mean pLDDT 89.7)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 27 functional partner(s); context anchor viuB
  • Essentiality: genome-wide transposon mutagenesis in H37Rv — DeJesus et al. 2017 (mBio, doi:10.1128/mBio.02133-16, CC BY)
  • Proteomics: integrated mass-spectrometry abundance from PaxDb 5.0 (Huang et al. 2023, doi:10.1016/j.mcpro.2023.100640), taxon 83332 — weighted average of 16 datasets, incl. Schubert et al. 2013 (doi:10.1016/j.chom.2013.04.008) and Albrethsen et al. 2013 (doi:10.1074/mcp.M112.018846)
  • Functional category: TubercuList scheme (Cole et al. 1998, doi:10.1038/31159), via Mycobrowser (Kapopoulou et al. 2011, doi:10.1016/j.tube.2010.09.006)
  • Orthologues: reciprocal best hits (DIAMOND, Buchfink et al. 2021, doi:10.1038/s41592-021-01101-x) against Mycobrowser release 5 reference proteomes
  • Genomic context / operon: H37Rv annotation; operon predicted by co-directional intergenic distance (Salgado et al. 2000, doi:10.1073/pnas.030539397)
  • Physico-chemical properties: ExPASy ProtParam method via Biopython (Gasteiger et al. 2005), computed from the MTBC0 sequence
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_003080|Rv2898c|
MTTLKTMTRVQLGAMGEALAVDYLTSMGLRILNRNWRCRYGELDVIACDAATRTVVFVEVKTRTGDGYGGLAHAVTERKVRRLRRLAGLWLADQEERWAAVRIDVIGVRVGPKNSGRTPELTHLQGIG