Rv2898c Family assigned · low auto-curated

H37Rv Rv2898c · MTBC0 mtbc0_003080 · 128 aa · 3228771–3229157 (-) · RefSeq NP_217414.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)hypothetical protein
MTBC0 PGAP re-annotationYraN family protein
Revised (this work)YraN family protein.

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt P9WFM9 SwissProt · reviewed · Inferred from homology
UniProt nameUPF0102 protein Rv2898c

UniProt still lists this protein as UPF0102 protein Rv2898c; the revised annotation above is ahead of the current UniProt record.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category L Replication, recombination and repair
Preferred nameyraN
eggNOG descriptionBelongs to the UPF0102 family
Orthologous groupCOG0792
KEGG orthology K07460

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS n/a
Polymorphic sites (≥ 0.1% of strains) 0 synonymous, 1 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
UPF0102PF02021.24 1.8e-2816–108 Uncharacterised protein family UPF0102

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: viuB (mycobactin utilization protein ViuB), high confidence from genomic context alone (score 837 excluding text-mining). This association is the citable seed of a function hypothesis for this hypothetical protein.

PartnerProductScoreNo text-miningChannels (≥400)
Rv2897c hyp hypothetical protein 965 963 ctx neighborhood:882 cooccurence:676
Rv2896c dprA hyp hypothetical protein 938 939 ctx neighborhood:882
Rv2895c viuB mycobactin utilization protein ViuB 837 837 ctx neighborhood:836
Rv2899c fdhD formate dehydrogenase accessory protein FdhD 729 729 ctx neighborhood:726
Rv1364c sigma factor regulatory protein 677 678 coexpression:667
Rv1354c hyp hypothetical protein 639 640 coexpression:628
Rv2594c ruvC crossover junction endodeoxyribonuclease RuvC 606 606 ctx cooccurence:592
Rv2894c xerC tyrosine recombinase XerC 599 600 ctx neighborhood:598
Rv2900c fdhF formate dehydrogenase subunit alpha FdhF 577 576 ctx neighborhood:570
Rv2903c lepB signal peptidase 497 497
Rv2901c hyp hypothetical protein 479 480 ctx neighborhood:473
Rv2414c hyp hypothetical protein 475 475
Rv2904c rplS 50S ribosomal protein L19 471 471
Rv2926c hyp hypothetical protein 463 463 ctx cooccurence:446
Rv2902c rnhB ribonuclease HII 438 438 ctx neighborhood:430

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: hypothetical protein
  • MTBC0 PGAP product: YraN family protein
  • Pfam (hmmscan --cut_ga): UPF0102 PF02021.24 (E=2e-28)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_217414.1)
  • Domains: Pfam-A via hmmscan --cut_ga — UPF0102 (PF02021.24)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG0792
  • Curated reference: UniProt P9WFM9 (SwissProt, reviewed; Inferred from homology)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 27 functional partner(s); context anchor viuB
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_003080|Rv2898c|
MTTLKTMTRVQLGAMGEALAVDYLTSMGLRILNRNWRCRYGELDVIACDAATRTVVFVEVKTRTGDGYGGLAHAVTERKVRRLRRLAGLWLADQEERWAAVRIDVIGVRVGPKNSGRTPELTHLQGIG