Rv2599 Family assigned · low

H37Rv Rv2599 · MTBC0 mtbc0_002766 · 143 aa · 2951030–2951461 (+) · RefSeq NP_217115.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)membrane protein
MTBC0 PGAP re-annotationDUF4247 domain-containing protein
Revised (this work)Membrane protein identified as a novel adhesin of M. tuberculosis: it binds the host extracellular-matrix proteins fibronectin, laminin and collagen (Kumar 2013). Also explored as a vaccine antigen. Molecular function = ECM-binding adhesin; further detail unfixed.

Curated reference (UniProt)

UniProt P9WL69 SwissProt · reviewed · Evidence at protein level
UniProt nameUncharacterized protein Rv2599

UniProt still lists this protein as Uncharacterized protein Rv2599; the revised annotation above is ahead of the current UniProt record.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category S Function unknown
eggNOG descriptionDomain of unknown function (DUF4247)
Orthologous group2BFFD
Gene Ontology (2) GO:0005575, GO:0005576

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.72 · relaxed/neutral
Polymorphic sites (≥ 0.1% of strains) 2 synonymous, 4 missense, 0 nonsense, 1 frameshift
Disruption 1 distinct premature-stop/frameshift site(s); most common in 0.14% of strains (204) · clonal

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
DUF4247PF14042.12 4.7e-4319–135 Domain of unknown function (DUF4247)

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: Rv2597 (membrane protein), high confidence from genomic context alone (score 876 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv2598 hyp hypothetical protein 888 888 ctx neighborhood:881
Rv2597 membrane protein 875 876 ctx neighborhood:874
Rv2600 integral membrane protein 793 793 ctx neighborhood:783
Rv2601 speE spermidine synthase 650 650 ctx neighborhood:638
Rv2596 vapC40 ribonuclease VapC40 545 545 ctx neighborhood:544
Rv2595 vapB40 antitoxin VapB40 544 544 ctx neighborhood:544
Rv3717 hyp hypothetical protein 724 47 textmining:723
Rv3500c yrbE4B integral membrane protein 513 46 textmining:511
Rv3501c yrbE4A integral membrane protein 426 46 textmining:423
Rv0071 maturase 513 45 textmining:511
Rv1940 ribA1 riboflavin biosynthesis protein RibA 644 44 textmining:643
Rv3505 fadE27 acyl-CoA dehydrogenase FadE27 430 42 textmining:430
Rv0309 hyp hypothetical protein 808 41 textmining:808
Rv3838c pheA prephenate dehydratase 578 41 textmining:578
Rv3062 ligB DNA ligase 436 41 textmining:436

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Membrane adhesin binding fibronectin/laminin/collagen (Kumar 2013, PMID 23922800)
  • Curated from the literature crible (project 'Still unknown gene function', 2026-06-09)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_217115.1)
  • Domains: Pfam-A via hmmscan --cut_ga — DUF4247 (PF14042.12)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG 2BFFD
  • Curated reference: UniProt P9WL69 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 16 functional partner(s); context anchor Rv2597
  • Primary literature: Kumar S, Puniya BL, Parween S, Nahar P, Ramachandran S (2013). Identification of novel adhesins of M. tuberculosis H37Rv using integrated approach of multiple computational algorithms and experimental analysis PLoS One 8(7):e69790. doi:10.1371/journal.pone.0069790 PMID:23922800

Ancestral MTBC0 protein sequence

>mtbc0_002766|Rv2599|
MSRNRLFLVAGILAVAAAVSLISGITLLNRDVGSYIASHYRQESRDVNGTRYLCTGSPKQVATTLVKYQTPAARASHTDTEYLRYRNNIVTVGPDGTYPCIIRVENLSAGYNHGAYVFLGPGFTPGSPSGGSGGSPGGPGGSK