Rv2600 Family assigned · low auto-curated

H37Rv Rv2600 · MTBC0 - · 133 aa · 2927990–2928391 (+) · RefSeq NP_217116.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)integral membrane protein
MTBC0 PGAP re-annotation
Revised (this work)Integral membrane protein.

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Annotated on the H37Rv protein: this gene has no 1:1 ancestral MTBC0 anchor (PE/PPE, paralogue, IS element, or otherwise unanchored CDS).

Curated reference (UniProt)

UniProt P9WFG5 SwissProt · reviewed · Inferred from homology
UniProt nameUPF0719 transmembrane protein Rv2600

UniProt still lists this protein as UPF0719 transmembrane protein Rv2600; the revised annotation above is ahead of the current UniProt record.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category S Function unknown
eggNOG descriptionDomain of Unknown Function (DUF350)
Orthologous groupCOG3766

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS n/a
Polymorphic sites (≥ 0.1% of strains) 0 synonymous, 1 missense, 0 nonsense, 1 frameshift
Disruption 1 distinct premature-stop/frameshift site(s); most common in 0.62% of strains (907) · clonal

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
DUF350PF03994.21 1.3e-163–132 Domain of Unknown Function (DUF350)

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: speE (spermidine synthase), high confidence from genomic context alone (score 953 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv2601 speE spermidine synthase 952 953 ctx neighborhood:881 cooccurence:596
Rv2597 membrane protein 946 946 ctx neighborhood:778 cooccurence:763
Rv2598 hyp hypothetical protein 914 915 ctx neighborhood:783 cooccurence:610
Rv2599 membrane protein 793 793 ctx neighborhood:783
Rv2593c ruvA Holliday junction ATP-dependent DNA helicase RuvA 604 603 ctx neighborhood:601
Rv2594c ruvC crossover junction endodeoxyribonuclease RuvC 602 602 ctx neighborhood:601
Rv2602 vapC41 ribonuclease VapC41 554 553 ctx neighborhood:551
Rv2601A vapB41 antitoxin VapB41 551 551 ctx neighborhood:551
Rv1417 membrane protein 529 529 ctx cooccurence:525
Rv1638A hyp hypothetical protein 468 468 ctx cooccurence:422
Rv3662c hyp hypothetical protein 433 434 ctx cooccurence:408
Rv3503c fdxD ferredoxin FdxD 419 420 ctx cooccurence:418
Rv3786c hyp hypothetical protein 415 415 ctx cooccurence:413
Rv3493c Mce associated protein 414 415 coexpression:415
Rv3134c universal stress protein 402 403 ctx cooccurence:401

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Annotation from H37Rv (no MTBC0 1:1 anchor; H37Rv protein used): integral membrane protein
  • Pfam (hmmscan --cut_ga): DUF350 PF03994.21 (E=1e-16)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_217116.1)
  • Domains: Pfam-A via hmmscan --cut_ga — DUF350 (PF03994.21)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG3766
  • Curated reference: UniProt P9WFG5 (SwissProt, reviewed; Inferred from homology)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 15 functional partner(s); context anchor speE
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>H37Rv|Rv2600|
MVATVLYFLVGAAVLVAGFLMVNLLTPGDLRRLVFIDRRPNAVVLAATMYVALAIVTIAAIYASSNQLAQGLIGVAVYGIVGVALQGVALVILEIAVPGRFREHIDAPALHPAVFATAVMLLAVAGVIAAALS