Rv2600 Family assigned · low auto-curated
H37Rv Rv2600 · MTBC0 - ·
133 aa · 2927990–2928391 (+) ·
RefSeq NP_217116.1
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | integral membrane protein |
|---|---|
| MTBC0 PGAP re-annotation | — |
| Revised (this work) | Integral membrane protein. |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
Annotated on the H37Rv protein: this gene has no 1:1 ancestral MTBC0 anchor (PE/PPE, paralogue, IS element, or otherwise unanchored CDS).
Curated reference (UniProt)
| UniProt |
P9WFG5
SwissProt · reviewed
· Inferred from homology
|
|---|---|
| UniProt name | UPF0719 transmembrane protein Rv2600 |
UniProt still lists this protein as UPF0719 transmembrane protein Rv2600; the revised annotation above is ahead of the current UniProt record.
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
S Function unknown
|
|---|---|
| eggNOG description | Domain of Unknown Function (DUF350) |
| Orthologous group | COG3766 |
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS | n/a |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 0 synonymous, 1 missense, 0 nonsense, 1 frameshift |
| Disruption | 1 distinct premature-stop/frameshift site(s); most common in 0.62% of strains (907) · clonal |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
DUF350 | PF03994.21 | 1.3e-16 | 3–132 | Domain of Unknown Function (DUF350) |
Functional interaction network (STRING v12, guilt-by-association)
Closest characterised functional partner: speE (spermidine synthase), high confidence from genomic context alone (score 953 excluding text-mining).
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv2601 speE |
spermidine synthase | 952 | 953 ctx | neighborhood:881 cooccurence:596 |
Rv2597 |
membrane protein | 946 | 946 ctx | neighborhood:778 cooccurence:763 |
Rv2598 hyp |
hypothetical protein | 914 | 915 ctx | neighborhood:783 cooccurence:610 |
Rv2599 |
membrane protein | 793 | 793 ctx | neighborhood:783 |
Rv2593c ruvA |
Holliday junction ATP-dependent DNA helicase RuvA | 604 | 603 ctx | neighborhood:601 |
Rv2594c ruvC |
crossover junction endodeoxyribonuclease RuvC | 602 | 602 ctx | neighborhood:601 |
Rv2602 vapC41 |
ribonuclease VapC41 | 554 | 553 ctx | neighborhood:551 |
Rv2601A vapB41 |
antitoxin VapB41 | 551 | 551 ctx | neighborhood:551 |
Rv1417 |
membrane protein | 529 | 529 ctx | cooccurence:525 |
Rv1638A hyp |
hypothetical protein | 468 | 468 ctx | cooccurence:422 |
Rv3662c hyp |
hypothetical protein | 433 | 434 ctx | cooccurence:408 |
Rv3503c fdxD |
ferredoxin FdxD | 419 | 420 ctx | cooccurence:418 |
Rv3786c hyp |
hypothetical protein | 415 | 415 ctx | cooccurence:413 |
Rv3493c |
Mce associated protein | 414 | 415 | coexpression:415 |
Rv3134c |
universal stress protein | 402 | 403 ctx | cooccurence:401 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Annotation from H37Rv (no MTBC0 1:1 anchor; H37Rv protein used): integral membrane protein
- Pfam (hmmscan --cut_ga): DUF350 PF03994.21 (E=1e-16)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_217116.1)
- Domains: Pfam-A via hmmscan --cut_ga — DUF350 (PF03994.21)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
COG3766 - Curated reference: UniProt P9WFG5 (SwissProt, reviewed; Inferred from homology)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
15 functional partner(s); context anchor
speE - Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>H37Rv|Rv2600| MVATVLYFLVGAAVLVAGFLMVNLLTPGDLRRLVFIDRRPNAVVLAATMYVALAIVTIAAIYASSNQLAQGLIGVAVYGIVGVALQGVALVILEIAVPGRFREHIDAPALHPAVFATAVMLLAVAGVIAAALS