Rv2603c Family assigned · medium auto-curated

H37Rv Rv2603c · MTBC0 mtbc0_002771 · 251 aa · 2954358–2955113 (-) · RefSeq NP_217119.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)transcriptional regulator
MTBC0 PGAP re-annotationYebC/PmpR family DNA-binding transcriptional regulator
Revised (this work)YebC/PmpR family DNA-binding transcriptional regulator. Pfam: TACO1_YebC_N (PF20772.3), Transcrip_reg (PF01709.27).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt P9WGA5 SwissProt · reviewed · Evidence at protein level
UniProt nameProbable transcriptional regulatory protein Rv2603c

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category K Transcription
Preferred nameyebC
eggNOG descriptiontranscriptional regulatory protein
Orthologous groupCOG0217
Gene Ontology (8) GO:0005575, GO:0005622, GO:0005623, GO:0005737, GO:0005829, GO:0044424, GO:0044444, GO:0044464

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.951 · relaxed/neutral
Polymorphic sites (≥ 0.1% of strains) 1 synonymous, 3 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
TACO1_YebC_NPF20772.3 1.3e-295–76 TACO1/YebC protein N-terminal domain
Transcrip_regPF01709.27 8.3e-5784–238 TACO1/YebC second and third domain

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: tesB2 (acyl-CoA thioesterase II), high confidence from genomic context alone (score 771 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv2605c tesB2 acyl-CoA thioesterase II 771 771 ctx neighborhood:757
Rv2604c snoP glutamine amidotransferase SnoP 854 760 ctx neighborhood:757 textmining:418
Rv2606c snzP pyridoxine biosynthesis protein 846 747 ctx neighborhood:735 textmining:418
Rv1630 rpsA 30S ribosomal protein S1 668 648 coexpression:429
Rv2904c rplS 50S ribosomal protein L19 641 642 coexpression:459
Rv3443c rplM 50S ribosomal protein L13 590 590 coexpression:437
Rv2534c efp elongation factor P 568 569 coexpression:423
Rv2572c aspS aspartate--tRNA ligase 625 566 coexpression:453
Rv2890c rpsB 30S ribosomal protein S2 543 544 coexpression:450
Rv2438c nadE glutamine-dependent NAD(+) synthetase 526 526 experimental:410
Rv1299 prfA peptide chain release factor PrfA 566 525
Rv1307 atpH ATP synthase subunit b/delta 540 524 coexpression:455
Rv2462c tig trigger factor 539 518 coexpression:479
Rv1650 pheT phenylalanine--tRNA ligase subunit beta 515 515
Rv3456c rplQ 50S ribosomal protein L17 509 509 coexpression:412

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: transcriptional regulator
  • MTBC0 PGAP product: YebC/PmpR family DNA-binding transcriptional regulator
  • Pfam (hmmscan --cut_ga): TACO1_YebC_N PF20772.3 (E=1e-29), Transcrip_reg PF01709.27 (E=8e-57)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_217119.1)
  • Domains: Pfam-A via hmmscan --cut_ga — TACO1_YebC_N (PF20772.3), Transcrip_reg (PF01709.27)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG0217
  • Curated reference: UniProt P9WGA5 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 50 functional partner(s); context anchor tesB2
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_002771|Rv2603c|
MSGHSKWATTKHKKAVVDARRGKMFARLIKNIEVAARVGGGDPAGNPTLYDAIQKAKKSSVPNENIERARKRGAGEEAGGADWQTIMYEGYAPNGVAVLIECLTDNRNRAASEVRVAMTRNGGTMADPGSVSYLFSRKGVVTLEKNGLTEDDVLAAVLEAGAEDVNDLGDSFEVISEPAELVAVRSALQDAGIDYESAEASFQPSVSVPVDLDGARKVFKLVDALEDSDDVQNVWTNVDVSDEVLAALDDE