vapC40 Family assigned · medium auto-curated

H37Rv Rv2596 · MTBC0 mtbc0_002763 · 134 aa · 2949287–2949691 (+) · RefSeq NP_217112.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)ribonuclease VapC40
MTBC0 PGAP re-annotationtype II toxin-antitoxin system VapC family toxin
Revised (this work)Type II toxin-antitoxin system VapC family toxin. Pfam: PIN (PF01850.28).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt P9WF61 SwissProt · reviewed · Evidence at protein level
UniProt nameRibonuclease VapC40
EC (curated) EC 3.1.-.-
Curated functionToxic component of a type II toxin-antitoxin (TA) system. An RNase (By similarity). Its cognate antitoxin is VapB40.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category S Function unknown
eggNOG descriptionToxic component of a toxin-antitoxin (TA) module. An RNase
Orthologous groupCOG1848

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS n/a
Polymorphic sites (≥ 0.1% of strains) 0 synonymous, 3 missense, 1 nonsense, 0 frameshift
Disruption 1 distinct premature-stop/frameshift site(s); most common in 0.20% of strains (290) · clonal

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
PINPF01850.28 1.5e-144–121 PIN domain

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: vapB40 (antitoxin VapB40), high confidence from genomic context alone (score 883 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv2595 vapB40 antitoxin VapB40 883 883 ctx neighborhood:882
Rv2597 membrane protein 590 590 ctx neighborhood:590
Rv2598 hyp hypothetical protein 587 587 ctx neighborhood:584
Rv2592c ruvB Holliday junction ATP-dependent DNA helicase RuvB 572 572 ctx neighborhood:567
Rv2593c ruvA Holliday junction ATP-dependent DNA helicase RuvA 572 572 ctx neighborhood:567
Rv2594c ruvC crossover junction endodeoxyribonuclease RuvC 570 571 ctx neighborhood:567
Rv2599 membrane protein 545 545 ctx neighborhood:544
Rv2601 speE spermidine synthase 416 416 ctx neighborhood:410
Rv2010 vapC15 ribonuclease VapC15 604 57 textmining:598
Rv1561 vapC11 ribonuclease VapC11 569 57 textmining:562
Rv0617 vapC29 ribonuclease VapC29 420 55 textmining:412
Rv0960 vapC9 ribonuclease VapC9 400 53
Rv3408 vapC47 ribonuclease VapC47 804 50 textmining:803
Rv0240 vapC24 ribonuclease VapC24 761 47 textmining:760
Rv2494 vapC38 ribonuclease VapC38 656 47 textmining:654

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: ribonuclease VapC40
  • MTBC0 PGAP product: type II toxin-antitoxin system VapC family toxin
  • Pfam (hmmscan --cut_ga): PIN PF01850.28 (E=1e-14)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_217112.1)
  • Domains: Pfam-A via hmmscan --cut_ga — PIN (PF01850.28)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG1848
  • Curated reference: UniProt P9WF61 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 22 functional partner(s); context anchor vapB40
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_002763|Rv2596|vapC40
MIAPDTSVLVAGFATWHEGHEAAVRALNRGVHLIAHAAVETYSVLTRLPPPHRIAPVAVHAYLADITSSNYLALDARSYRGLTDHLAEHDVTGGATYDALVGFTAKAAGAKLLTRDLRAVETYERLRVEVELVT