snzP Family assigned · medium auto-curated
H37Rv Rv2606c · MTBC0 mtbc0_002774 ·
299 aa ·
2956724–2957623 MTBC0
(-) ·
RefSeq NP_217122.1
Genomic neighbourhood (genome browser)
Open in full genome browser →This gene (outlined) in its genomic context; arrows are neighbouring genes coloured by verdict. Click any gene to navigate. Pan and zoom in the full browser.
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | pyridoxine biosynthesis protein |
|---|---|
| MTBC0 PGAP re-annotation | pyridoxal 5'-phosphate synthase lyase subunit PdxS |
| Revised (this work) | Pyridoxal 5'-phosphate synthase lyase subunit PdxS. Pfam: SOR_SNZ (PF01680.24). |
| Functional category (TubercuList) | intermediary metabolism and respiration |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
In the literature (TB corpus sweep) 4 publications
4 TB publications mention this gene. 4 publication(s) discuss this gene (4 in a M. tuberculosis context, 1 in other mycobacteria — M. marinum (1)).
| Publication | Date |
|---|---|
| Cloning, expression, purification, crystallization and X-ray crystallographic analysis of Rv2606c from Mycobacterium tuberculosis H37Rv. doi:10.1107/S1744309113010683 | 2013 |
| Crystal structure of Mycobacterium tuberculosis Rv2606c: a pyridoxal biosynthesis lyase. doi:10.1016/j.bbrc.2013.04.068 | 2013 |
| Vitamin B6 biosynthesis is essential for survival and virulence of Mycobacterium tuberculosis. doi:10.1111/j.1365-2958.2010.07381.x | 2010 |
| Transposon mutagenesis of Mycobacterium marinum identifies a locus linking pigmentation and intracellular survival. doi:10.1128/IAI.71.2.922-929.2003 | 2003 |
This layer CITES the literature and adds context; it does not change the verdict or the function stated elsewhere in this fiche. This distinguishes a gene that is dark because nobody has looked from one that is dark despite having been studied. Source: PubMed (whole): H37Rv locus tag + GENE NAME + ortholog identifiers (Mb…, MMAR_…, MSMEG_…, ML…, MAB_…), under a mycobacterial context filter; hits verified against the abstract text. Species-context counts distinguish M. tuberculosis literature from literature on other mycobacteria. phase76/phase77, 2026-07-13.
CRISPRi vulnerability
Vulnerability index 0.93 (95% CI -0.81 to 3.49). A more negative index = more vulnerable to knockdown (better drug-target quality); indicative threshold VI ≤ -6 = highly vulnerable.
Quantitative CRISPRi knockdown, graded (finer than binary Tn-seq essentiality). Source: CRISPRi vulnerability index (Bosch 2021, pebble.rockefeller.edu).
Legacy record & comparison (Mycobrowser)
| Mycobrowser function | Possibly involved in the biosynthesis of pyridoxine/pyridoxal 5-phosphate biosynthesis |
|---|---|
| Mycobrowser EC |
4.-.-.-
· superseded EC numbering; the atlas uses the current class (4.3.3.6)
|
The legacy Mycobrowser record is shown for verification. Mycobrowser is no longer maintained; its EC numbers predate recent nomenclature revisions, so a class change usually reflects re-numbering, not a conflict.
Orthologues (reciprocal best hits across mycobacteria)
| M. bovis |
Mb2638c
· 100.0% identity |
|---|---|
| M. leprae |
ML0450c
· 89.7% identity |
| M. marinum |
MMAR_2094
· 95.7% identity |
| M. smegmatis |
MSMEG_2937
· 93.5% identity |
| M. orygis |
RJtmp_002698
· 100.0% identity |
| M. abscessus |
MAB_2892c
· 91.8% identity |
Reciprocal-best-hit orthologues (DIAMOND) against the Mycobrowser reference proteomes. A missing species is informative: e.g. a gene absent from M. leprae was likely lost in its reductive genome evolution. Locus tags link to Mycobrowser.
Curated reference (UniProt)
| UniProt |
P9WII9
SwissProt · reviewed
· Evidence at protein level
|
|---|---|
| UniProt name | Pyridoxal 5'-phosphate synthase subunit PdxS |
| EC (curated) |
EC 4.3.3.6
|
| Curated function | Catalyzes the formation of pyridoxal 5'-phosphate from ribose 5-phosphate (RBP), glyceraldehyde 3-phosphate (G3P) and ammonia. The ammonia is provided by the PdxT subunit. Can also use ribulose 5-phosphate and dihydroxyacetone phosphate as substrates, resulting from enzyme-catalyzed isomerization of RBP and G3P, respectively. |
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
H Coenzyme transport and metabolism
|
|---|---|
| Preferred name | pdxS |
| eggNOG description | Catalyzes the formation of pyridoxal 5'-phosphate from ribose 5-phosphate (RBP), glyceraldehyde 3-phosphate (G3P) and ammonia. The ammonia is provided by the PdxT subunit. Can also use ribulose 5-phosphate and dihydroxyacetone phosphate as substrates, resulting from enzyme-catalyzed isomerization of RBP and G3P, respectively |
| Orthologous group | COG0214 |
| EC number |
EC 4.3.3.6
|
| KEGG orthology |
K06215
|
| KEGG pathways |
map00750
|
| Gene Ontology (56) |
GO:0003674, GO:0003824, GO:0005575, GO:0005623, GO:0005886, GO:0006081, GO:0006725, GO:0006732, GO:0006766, GO:0006767, GO:0006793, GO:0006796 +44 more
|
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS | 1.32 · diversifying/relaxed |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 1 synonymous, 4 missense, 0 nonsense, 0 frameshift |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Outgroup conservation (beyond the MTBC) Bacteria
| M. canettii dN/dS (deep-divergence selection) |
0.0 (low power)
· 3 consensus substitution(s) low power (3 canettii-consensus substitution(s)); present in M. canettii but dN/dS not reliable |
|---|---|
| Genus-wide presence (~53 non-MTBC Mycobacterium) |
present in 52/53 (98%) · mean identity 92.9%
· 4/4 closest MTBAP relatives conserved across the genus (present in 52/53 non-MTBC Mycobacterium genomes, incl. distant relatives) — an ancient core gene predating the genus radiation |
| Phylostratum (deepest detected homolog) |
MTBC-specific → Mycobacterium → Mycobacteriaceae → Corynebacteriales → Actinomycetia → Bacteria detected in 12/13 non-Mycobacterium reference genomes (down to Bacteria) · mean identity 81.0% detected down to outside the phylum (Proteobacteria/Firmicutes controls) — a universally conserved, ancient bacterial gene |
Two orthogonal outgroup signals. M. canettii (the immediate outgroup) gives a deep-divergence dN/dS (a low value confirms a constrained, real gene; shown as confident only at ≥8 substitutions, else flagged low-power). Genus-wide presence/absence (tblastn vs assembled non-MTBC genomes) places the gene on the ancient-core ↔ MTBC-specific axis: a gene absent even from the closest MTBAP relatives is a candidate MTBC-specific innovation (possible host-adaptation factor, to confirm by synteny). The phylostratum extends that axis outside the genus (tblastn vs 13 reference genomes spanning Mycobacteriaceae → Corynebacteriales → Actinomycetia → outside the phylum): it is the deepest clade in which a homolog is still detected, i.e. a proxy for gene age. Read it with the null model in mind: a shallow (young) stratum can also reflect homology-detection failure for short or fast-evolving ORFs, so it is a descriptive axis, not a proof of novelty.
Essentiality (transposon mutagenesis)
| DeJesus 2017 call | NE · non-essential |
|---|---|
| What the call means | non-essential |
| TA sites (Himar1) | 12 in the ORF — 0 in the essential state, 0 growth-defect, 12 non-essential, 0 growth-advantage. Saturation 0.917, mean read count 35.4545454545. A region of the protein devoid of TA sites is invisible to this assay: nothing can be inferred about it, in either direction. |
Genome-wide Himar1 transposon essentiality in H37Rv (DeJesus 2017). An essential call (ES/ESD/GD) is strong, independent evidence that a "hypothetical" locus encodes a functional, selectively required gene — orthogonal to intra-species conservation.
Mutant phenotypes (conditional Tn-seq, MtbTnDB) in-vivo phenotype
| Condition | log2FC | q | Effect |
|---|---|---|---|
| fitness in mouse infection, day 45 (in vivo) | -6.32 | 0.0 | required |
| fitness after prolonged in vitro passage (in vitro passage) | -6.22 | 0.0 | required |
| fitness in mouse infection (in vivo) | -6.01 | 0.022 | required |
| fitness in mouse infection (in vivo) | -5.56 | 0.022 | required |
| fitness in mouse infection (in vivo) | -5.56 | 0.012 | required |
| fitness in mouse infection (in vivo) | -5.56 | 0.017 | required |
| fitness in mouse infection (in vivo) | -5.56 | 0.022 | required |
| fitness in mouse infection, day 10 (in vivo) | -5.55 | 0.011 | required |
| fitness in mouse infection (in vivo) | -5.55 | 0.017 | required |
| fitness in mouse infection (in vivo) | -5.55 | 0.013 | required |
| fitness in mouse infection (in vivo) | -5.55 | 0.021 | required |
| fitness in mouse infection (in vivo) | -5.55 | 0.012 | required |
Conditional fitness of transposon-disruption mutants across 17 significant condition(s) (|log2FC|≥1, q≤0.05), from the standardized MtbTnDB compendium. A negative log2FC means the mutant is depleted — the gene contributes to fitness in that condition. An in-vivo defect for a "hypothetical" is strong evidence it matters for infection, even without a known molecular function. Disruption (Tn insertion), not a clean deletion; genetic-interaction screens excluded.
Proteomics (mass spectrometry) detected
| MS detection | detected in 15 of 16 independent MS datasets |
|---|---|
| Integrated abundance | 519.0 ppm · rank 390/3519 (88.9th percentile) |
Detection by mass spectrometry is direct, experimental evidence that the protein product exists — orthogonal to sequence conservation and to Tn-seq essentiality, and especially decisive for a "hypothetical" locus. Reproducible detection across several independent datasets (PaxDb) makes the existence claim robust; the integrated abundance places the protein in the proteome's dynamic range.
Physico-chemical properties (computed, ProtParam)
| Length | 299 aa |
|---|---|
| Molecular weight | 31.4 kDa |
| Theoretical pI | 5.24 |
| GRAVY | 0.148 (hydrophobic) |
| Aliphatic index | 91.8 |
| Aromaticity | 0.047 |
| Instability index | 30.5 (stable) |
Computed from the ancestral MTBC0 sequence with the ExPASy ProtParam method (Biopython). Descriptive biophysical context: a positive GRAVY flags a hydrophobic (often membrane) protein, a high instability index (>40) predicts a short in-vitro half-life, an extreme pI hints at compartment or binding partner.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
SOR_SNZ | PF01680.24 | 3.7e-106 | 12–217 | SOR/SNZ family |
Experimental structures (Protein Data Bank) 1 solved
| PDB | Method | Resolution | Coverage |
|---|---|---|---|
4jdy |
X-ray diffraction | 1.8 Å | 88% |
Experimentally solved structures mapped from the UniProt accession via PDBe/SIFTS (1 total; up to 8 shown, ranked by sequence coverage then resolution). An experimental structure is direct proof of the folded product and the strongest structural evidence — superseding the predicted ESMFold/AlphaFold models below for any covered region.
Structural search (AlphaFold DB model, Foldseek vs PDB — genome-wide) pLDDT 94.8
| PDB hit | prob | TM-score | E-value | Description |
|---|---|---|---|---|
4jdy-assembly1_A |
1.00 | 0.97 | 3.1e-46 sig | 4jdy-assembly1_A Crystal structure of Rv2606c |
9dvf-assembly1_A |
1.00 | 0.99 | 3.7e-44 sig | 9dvf-assembly1_A Structure of the native PLP synthase subunit PdxS from Methanosarcina acetivorans |
5k2z-assembly1_D |
1.00 | 0.99 | 3.1e-42 sig | 5k2z-assembly1_D PDX1.3-adduct (Arabidopsis) |
5lnt-assembly1_A |
1.00 | 0.99 | 4.6e-42 sig | 5lnt-assembly1_A Crystal structure of Arabidopsis thaliana Pdx1K166R-preI320 complex |
7nhe-assembly1_A-3 |
1.00 | 1.00 | 2.1e-41 sig | 7nhe-assembly1_A-3 Crystal structure of Arabidopsis thaliana Pdx1K166R-I333 complex |
Foldseek search of the AlphaFold DB model (mean pLDDT 94.8, gated at 70) against the PDB — a genome-wide extension of the ESMFold dark-gene search that also covers proteins beyond the single-sequence length limit. Confident structural neighbours (E < 0.01) shown.
Genomic context (neighbours & predicted operon) operon of 3
| Upstream (5' on genome) | tesB2 (- strand, 28 bp gap) |
|---|---|
| Downstream (3' on genome) | pdxH (+ strand, 127 bp gap) |
| Predicted operon |
snoP · tesB2 · snzP
|
Neighbours from the H37Rv annotation (- strand). The operon is predicted by co-directional intergenic distance (same strand, gaps ≤50 bp) — a transcription-unit hypothesis, not a mapped TSS. For a "hypothetical", co-transcription with a characterised operon is a concrete functional lead (complements the STRING neighborhood channel below).
Functional interaction network (STRING v12, guilt-by-association)
Explore full network →Node colour = verdict, dashed = hypothetical; edge colour = evidence (green experimental, orange genomic-context, grey co-expression), width ∝ score. Click a partner to open its page; "Explore full network" to walk the graph.
Closest characterised functional partner: snoP (glutamine amidotransferase SnoP), high confidence from genomic context alone (score 1000 excluding text-mining).
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv2604c snoP exp |
glutamine amidotransferase SnoP | 999 | 1000 ctx | neighborhood:822 cooccurence:774 coexpression:855 experimental:928 database:900 textmining:948 |
Rv2607 pdxH exp |
pyridoxine/pyridoxamine 5'-phosphate oxidase | 988 | 953 ctx | neighborhood:550 database:900 textmining:757 |
Rv2605c tesB2 |
acyl-CoA thioesterase II | 980 | 860 ctx | neighborhood:823 textmining:870 |
Rv1449c tkt exp |
transketolase | 830 | 824 | database:800 |
Rv1448c tal exp |
transaldolase | 826 | 818 | database:800 |
Rv1017c prsA exp |
ribose-phosphate pyrophosphokinase | 815 | 816 | database:800 |
Rv2465c rpiB exp |
ribose-5-phosphate isomerase B | 804 | 804 | database:800 |
Rv3068c pgmA exp |
phosphoglucomutase PgmA | 800 | 801 | database:800 |
Rv2436 rbsK exp |
ribokinase RbsK | 819 | 800 | database:800 |
Rv1436 gap |
glyceraldehyde 3-phosphate dehydrogenase | 810 | 782 ctx | fusion:757 |
Rv2603c |
transcriptional regulator | 846 | 747 ctx | neighborhood:735 textmining:418 |
Rv1295 thrC |
threonine synthase | 724 | 661 | coexpression:655 |
Rv2614c thrS |
threonine--tRNA ligase | 563 | 563 ctx | neighborhood:544 |
Rv2613c |
AP-4-A phosphorylase | 557 | 558 ctx | neighborhood:544 |
Rv2610c pimA |
alpha-(1-2)-phosphatidylinositol mannosyltransferase | 527 | 515 ctx | neighborhood:510 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The exp badge marks an experimentally-supported partner (measured interaction, experimental/database channel ≥400) as opposed to a purely predicted one — but note that the M. tuberculosis experimental interactome is dominated by a noisy bacterial-two-hybrid screen, so a strong measured link that contradicts the operon/localisation context is likely a false positive. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Legacy H37Rv annotation: pyridoxine biosynthesis protein
- MTBC0 PGAP product: pyridoxal 5'-phosphate synthase lyase subunit PdxS
- Pfam (hmmscan --cut_ga): SOR_SNZ PF01680.24 (E=4e-106)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_217122.1)
- Domains: Pfam-A via hmmscan --cut_ga — SOR_SNZ (PF01680.24)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
COG0214 - Curated reference: UniProt P9WII9 (SwissProt, reviewed; Evidence at protein level)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Genome-wide structure: AlphaFold DB model (Jumper et al. 2021, doi:10.1038/s41586-021-03819-2; Varadi et al. 2024, doi:10.1093/nar/gkad1011) searched vs PDB with Foldseek (mean pLDDT 94.8)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
28 functional partner(s); context anchor
snoP - Essentiality: genome-wide transposon mutagenesis in H37Rv — DeJesus et al. 2017 (mBio, doi:10.1128/mBio.02133-16, CC BY)
- Proteomics: integrated mass-spectrometry abundance from PaxDb 5.0 (Huang et al. 2023, doi:10.1016/j.mcpro.2023.100640), taxon 83332 — weighted average of 16 datasets, incl. Schubert et al. 2013 (doi:10.1016/j.chom.2013.04.008) and Albrethsen et al. 2013 (doi:10.1074/mcp.M112.018846)
- Functional category: TubercuList scheme (Cole et al. 1998, doi:10.1038/31159), via Mycobrowser (Kapopoulou et al. 2011, doi:10.1016/j.tube.2010.09.006)
- Orthologues: reciprocal best hits (DIAMOND, Buchfink et al. 2021, doi:10.1038/s41592-021-01101-x) against Mycobrowser release 5 reference proteomes
- Experimental structures: PDBe/SIFTS UniProt→PDB mapping (Dana et al. 2019, doi:10.1093/nar/gky1114)
- Genomic context / operon: H37Rv annotation; operon predicted by co-directional intergenic distance (Salgado et al. 2000, doi:10.1073/pnas.030539397)
- Mutant phenotypes: standardized Tn-seq compendium MtbTnDB (Jinich et al. 2025, doi:10.1111/mmi.15370), aggregating many primary Tn-seq studies across conditions
- Physico-chemical properties: ExPASy ProtParam method via Biopython (Gasteiger et al. 2005), computed from the MTBC0 sequence
- Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>mtbc0_002774|Rv2606c|snzP MDPAGNPATGTARVKRGMAEMLKGGVIMDVVTPEQARIAEGAGAVAVMALERVPADIRAQGGVSRMSDPDMIEGIIAAVTIPVMAKVRIGHFVEAQILQTLGVDYIDESEVLTPADYAHHIDKWNFTVPFVCGATNLGEALRRISEGAAMIRSKGEAGTGDVSNATTHMRAIGGEIRRLTSMSEDELFVAAKELQAPYELVAEVARAGKLPVTLFTAGGIATPADAAMMMQLGAEGVFVGSGIFKSGAPEHRAAAIVKATTFFDDPDVLAKVSRGLGEAMVGINVDEIAVGHRLAQRGW
Spot an error? Suggest an improvement
Found a mistake, a missing reference, or have a better functional hypothesis for snzP? Email the maintainer — the message is pre-filled with this gene's details.