snzP Family assigned · medium auto-curated

H37Rv Rv2606c · MTBC0 mtbc0_002774 · 299 aa · 2956724–2957623 (-) · RefSeq NP_217122.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)pyridoxine biosynthesis protein
MTBC0 PGAP re-annotationpyridoxal 5'-phosphate synthase lyase subunit PdxS
Revised (this work)Pyridoxal 5'-phosphate synthase lyase subunit PdxS. Pfam: SOR_SNZ (PF01680.24).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt P9WII9 SwissProt · reviewed · Evidence at protein level
UniProt namePyridoxal 5'-phosphate synthase subunit PdxS
EC (curated) EC 4.3.3.6
Curated functionCatalyzes the formation of pyridoxal 5'-phosphate from ribose 5-phosphate (RBP), glyceraldehyde 3-phosphate (G3P) and ammonia. The ammonia is provided by the PdxT subunit. Can also use ribulose 5-phosphate and dihydroxyacetone phosphate as substrates, resulting from enzyme-catalyzed isomerization of RBP and G3P, respectively.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category H Coenzyme transport and metabolism
Preferred namepdxS
eggNOG descriptionCatalyzes the formation of pyridoxal 5'-phosphate from ribose 5-phosphate (RBP), glyceraldehyde 3-phosphate (G3P) and ammonia. The ammonia is provided by the PdxT subunit. Can also use ribulose 5-phosphate and dihydroxyacetone phosphate as substrates, resulting from enzyme-catalyzed isomerization of RBP and G3P, respectively
Orthologous groupCOG0214
EC number EC 4.3.3.6
KEGG orthology K06215
KEGG pathways map00750
Gene Ontology (56) GO:0003674, GO:0003824, GO:0005575, GO:0005623, GO:0005886, GO:0006081, GO:0006725, GO:0006732, GO:0006766, GO:0006767, GO:0006793, GO:0006796 +44 more

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 1.32 · diversifying/relaxed
Polymorphic sites (≥ 0.1% of strains) 1 synonymous, 4 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
SOR_SNZPF01680.24 3.7e-10612–217 SOR/SNZ family

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: snoP (glutamine amidotransferase SnoP), high confidence from genomic context alone (score 1000 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv2604c snoP glutamine amidotransferase SnoP 999 1000 ctx neighborhood:822 cooccurence:774 coexpression:855 experimental:928 database:900 textmining:948
Rv2607 pdxH pyridoxine/pyridoxamine 5'-phosphate oxidase 988 953 ctx neighborhood:550 database:900 textmining:757
Rv2605c tesB2 acyl-CoA thioesterase II 980 860 ctx neighborhood:823 textmining:870
Rv1449c tkt transketolase 830 824 database:800
Rv1448c tal transaldolase 826 818 database:800
Rv1017c prsA ribose-phosphate pyrophosphokinase 815 816 database:800
Rv2465c rpiB ribose-5-phosphate isomerase B 804 804 database:800
Rv3068c pgmA phosphoglucomutase PgmA 800 801 database:800
Rv2436 rbsK ribokinase RbsK 819 800 database:800
Rv1436 gap glyceraldehyde 3-phosphate dehydrogenase 810 782 ctx fusion:757
Rv2603c transcriptional regulator 846 747 ctx neighborhood:735 textmining:418
Rv1295 thrC threonine synthase 724 661 coexpression:655
Rv2614c thrS threonine--tRNA ligase 563 563 ctx neighborhood:544
Rv2613c AP-4-A phosphorylase 557 558 ctx neighborhood:544
Rv2610c pimA alpha-(1-2)-phosphatidylinositol mannosyltransferase 527 515 ctx neighborhood:510

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: pyridoxine biosynthesis protein
  • MTBC0 PGAP product: pyridoxal 5'-phosphate synthase lyase subunit PdxS
  • Pfam (hmmscan --cut_ga): SOR_SNZ PF01680.24 (E=4e-106)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_217122.1)
  • Domains: Pfam-A via hmmscan --cut_ga — SOR_SNZ (PF01680.24)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG0214
  • Curated reference: UniProt P9WII9 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 28 functional partner(s); context anchor snoP
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_002774|Rv2606c|snzP
MDPAGNPATGTARVKRGMAEMLKGGVIMDVVTPEQARIAEGAGAVAVMALERVPADIRAQGGVSRMSDPDMIEGIIAAVTIPVMAKVRIGHFVEAQILQTLGVDYIDESEVLTPADYAHHIDKWNFTVPFVCGATNLGEALRRISEGAAMIRSKGEAGTGDVSNATTHMRAIGGEIRRLTSMSEDELFVAAKELQAPYELVAEVARAGKLPVTLFTAGGIATPADAAMMMQLGAEGVFVGSGIFKSGAPEHRAAAIVKATTFFDDPDVLAKVSRGLGEAMVGINVDEIAVGHRLAQRGW