Rv2926c Family assigned · medium auto-curated

H37Rv Rv2926c · MTBC0 - · 207 aa · 3240548–3241171 (-) · RefSeq NP_217442.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)hypothetical protein
MTBC0 PGAP re-annotation
Revised (this work)Contains YceD (PF02620.23) domain(s); putative function inferred from the domain architecture.

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Annotated on the H37Rv protein: this gene has no 1:1 ancestral MTBC0 anchor (PE/PPE, paralogue, IS element, or otherwise unanchored CDS).

Curated reference (UniProt)

UniProt P9WL17 SwissProt · reviewed · Evidence at protein level
UniProt nameUncharacterized protein Rv2926c

UniProt still lists this protein as Uncharacterized protein Rv2926c; the revised annotation above is ahead of the current UniProt record.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category S Function unknown
eggNOG descriptionUncharacterized ACR, COG1399
Orthologous groupCOG1399
KEGG orthology K07040
Gene Ontology (2) GO:0008150, GO:0040007

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 1.064 · relaxed/neutral
Polymorphic sites (≥ 0.1% of strains) 2 synonymous, 6 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
YceDPF02620.23 7.1e-2984–193 Large ribosomal RNA subunit accumulation protein YceD

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: rnc (ribonuclease III), high confidence from genomic context alone (score 939 excluding text-mining). This association is the citable seed of a function hypothesis for this hypothetical protein.

PartnerProductScoreNo text-miningChannels (≥400)
Rv2925c rnc ribonuclease III 992 939 ctx neighborhood:882 coexpression:505 textmining:877
Rv0707 rpsC 30S ribosomal protein S3 931 932 coexpression:763 experimental:724
Rv0979A rpmF 50S ribosomal protein L32 882 868 coexpression:857
Rv0640 rplK 50S ribosomal protein L11 855 856 coexpression:856
Rv0641 rplA 50S ribosomal protein L1 850 843 coexpression:843
Rv1642 rpmI 50S ribosomal protein L35 835 835 coexpression:795
Rv0053 rpsF 30S ribosomal protein S6 833 834 coexpression:820
Rv2890c rpsB 30S ribosomal protein S2 832 833 coexpression:821
Rv2909c rpsP 30S ribosomal protein S16 831 832 coexpression:818
Rv1641 infC initiation factor IF-3 831 832 coexpression:820
Rv3443c rplM 50S ribosomal protein L13 831 832 coexpression:829
Rv0651 rplJ 50S ribosomal protein L10 830 831 coexpression:803
Rv2442c rplU 50S ribosomal protein L21 829 830 coexpression:824
Rv2927c sepIVA hyp hypothetical protein 985 821 ctx neighborhood:813 textmining:920
Rv0700 rpsJ 30S ribosomal protein S10 820 821 coexpression:821

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Annotation from H37Rv (no MTBC0 1:1 anchor; H37Rv protein used): hypothetical protein
  • Pfam (hmmscan --cut_ga): YceD PF02620.23 (E=7e-29)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_217442.1)
  • Domains: Pfam-A via hmmscan --cut_ga — YceD (PF02620.23)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG1399
  • Curated reference: UniProt P9WL17 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 115 functional partner(s); context anchor rnc
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>H37Rv|Rv2926c|
MDLGGVRRRISLMARQHGPTAQRHVASPMTVDIARLGRRPGAMFELHDTVHSPARIGLELIAIDQGALLDLDLRVESVSEGVLVTGTVAAPTVGECARCLSPVRGRVQVALTELFAYPDSATDETTEEDEVGRVVDETIDLEQPIIDAVGLELPFSPVCRPDCPGLCPQCGVPLASEPGHRHEQIDPRWAKLVEMLGPESDTLRGER