nusB Resolved · high auto-curated

H37Rv Rv2533c · MTBC0 mtbc0_002699 · 156 aa · 2881144–2881614 (-) · RefSeq NP_217049.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)N utilization substance protein B
MTBC0 PGAP re-annotationtranscription antitermination factor NusB
Revised (this work)Transcription antitermination factor NusB. Pfam: NusB (PF01029.24).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt P9WIV1 SwissProt · reviewed · Evidence at protein level
UniProt nameTranscription antitermination protein NusB
Curated functionInvolved in transcription antitermination. Required for transcription of ribosomal RNA (rRNA) genes. Binds specifically to the boxA antiterminator sequence of the ribosomal RNA (rrn) operons.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category K Transcription
Preferred namenusB
eggNOG descriptionInvolved in transcription antitermination. Required for transcription of ribosomal RNA (rRNA) genes. Binds specifically to the boxA antiterminator sequence of the ribosomal RNA (rrn) operons
Orthologous groupCOG0781
KEGG orthology K03625
Gene Ontology (2) GO:0008150, GO:0040007

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS n/a
Polymorphic sites (≥ 0.1% of strains) 0 synonymous, 2 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
NusBPF01029.24 1.1e-3211–139 NusB family

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: efp (elongation factor P), high confidence from genomic context alone (score 910 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv2532c hyp hypothetical protein 968 969 ctx neighborhood:882 coexpression:744
Rv2534c efp elongation factor P 957 910 ctx neighborhood:882 textmining:540
Rv2535c pepQ cytoplasmic peptidase PepQ 911 888 ctx neighborhood:882
Rv0700 rpsJ 30S ribosomal protein S10 892 835 experimental:822
Rv2841c nusA transcription termination/antitermination protein NusA 900 815 experimental:652 textmining:482
Rv1390 rpoZ DNA-directed RNA polymerase subunit omega 745 711 coexpression:416 experimental:446
Rv3404c hyp hypothetical protein 710 683 coexpression:650
Rv1416 ribH 6,7-dimethyl-8-ribityllumazine synthase 773 680 coexpression:662
Rv1406 fmt methionyl-tRNA formyltransferase 708 680 coexpression:647
Rv2531c amino acid decarboxylase 687 668 ctx neighborhood:652
Rv2536 transmembrane protein 650 650 ctx neighborhood:646
Rv0667 rpoB DNA-directed RNA polymerase subunit beta 652 610 experimental:446
Rv0639 nusG transcription termination/antitermination protein NusG 961 600 experimental:420 textmining:908
Rv1630 rpsA 30S ribosomal protein S1 598 583 coexpression:432
Rv0668 rpoC DNA-directed RNA polymerase subunit beta' 602 577 experimental:446

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: N utilization substance protein B
  • MTBC0 PGAP product: transcription antitermination factor NusB
  • Pfam (hmmscan --cut_ga): NusB PF01029.24 (E=1e-32)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_217049.1)
  • Domains: Pfam-A via hmmscan --cut_ga — NusB (PF01029.24)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG0781
  • Curated reference: UniProt P9WIV1 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 77 functional partner(s); context anchor efp
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_002699|Rv2533c|nusB
MSDRKPVRGRHQARKRAVDLLFEAEVRGISAAEVVDTRAALAEAKPDIARLHPYTAAVARGVSEHAAHIDDLITAHLRGWTLDRLPAVDRAILRVSVWELLHAADVPEPVVVDEAVQLAKELSTDDSPGFVNGVLGQVMLVTPQLRAAAQAVRGGA