aroB Resolved · high auto-curated

H37Rv Rv2538c · MTBC0 mtbc0_002704 · 362 aa · 2884478–2885566 (-) · RefSeq NP_217054.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)3-dehydroquinate synthase
MTBC0 PGAP re-annotation3-dehydroquinate synthase
Revised (this work)3-dehydroquinate synthase. Pfam: Fe-ADH_2 (PF13685.13), DHQ_synthase (PF01761.27), DHQS_C (PF24621.3).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt P9WPX9 SwissProt · reviewed · Evidence at protein level
UniProt name3-dehydroquinate synthase
EC (curated) EC 4.2.3.4
Curated functionCatalyzes the conversion of 3-deoxy-D-arabino-heptulosonate 7-phosphate (DAHP) to dehydroquinate (DHQ).

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category E Amino acid transport and metabolism
Preferred namearoB
eggNOG descriptionCatalyzes the conversion of 3-deoxy-D-arabino- heptulosonate 7-phosphate (DAHP) to dehydroquinate (DHQ)
Orthologous groupCOG0337
EC number EC 2.7.1.71, EC 4.2.3.4
KEGG orthology K01735, K13829
KEGG pathways map00400, map01100, map01110, map01130, map01230
KEGG modules M00022
Gene Ontology (58) GO:0003674, GO:0003824, GO:0003856, GO:0005488, GO:0005507, GO:0005575, GO:0005618, GO:0005622, GO:0005623, GO:0005737, GO:0005829, GO:0005886 +46 more

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.0 · strong purifying
Polymorphic sites (≥ 0.1% of strains) 5 synonymous, 0 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
Fe-ADH_2PF13685.13 2.7e-0721–175 Iron-containing alcohol dehydrogenase
DHQ_synthasePF01761.27 4.9e-4269–180 3-dehydroquinate synthase N-terminal
DHQS_CPF24621.3 5.4e-46183–325 3-dehydroquinate synthase C-terminal

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: aroK (shikimate kinase), high confidence from genomic context alone (score 1000 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv2539c aroK shikimate kinase 999 1000 ctx neighborhood:882 fusion:900 cooccurence:753 coexpression:942 textmining:929
Rv2537c aroD 3-dehydroquinate dehydratase 999 998 ctx neighborhood:882 fusion:681 database:900 textmining:588
Rv2540c aroF chorismate synthase 999 994 ctx neighborhood:882 cooccurence:751 coexpression:813 textmining:922
Rv3227 aroA 3-phosphoshikimate 1-carboxyvinyltransferase 992 986 ctx fusion:900 cooccurence:645 coexpression:580 textmining:510
Rv2552c aroE shikimate 5-dehydrogenase 994 984 ctx neighborhood:409 fusion:900 cooccurence:688 textmining:677
Rv2178c aroG phospho-2-dehydro-3-deoxyheptonate aldolase AroG 992 916 database:900 textmining:911
Rv3754 tyrA prephenate dehydrogenase TyrA 884 712 coexpression:499 textmining:614
Rv1026 ppx2 hyp hypothetical protein 646 646 ctx fusion:608
Rv3100c smpB SsrA-binding protein 640 641 coexpression:629
Rv3419c gcp O-sialoglycoprotein endopeptidase 597 597 ctx fusion:567
Rv2541 hyp hypothetical protein 570 570 ctx neighborhood:569
Rv3859c gltB glutamate synthase large subunit 569 545 ctx neighborhood:544
Rv2551c hyp hypothetical protein 541 542 ctx neighborhood:535
Rv3772 hisC2 histidinol-phosphate aminotransferase 558 510 coexpression:426
Rv0013 trpG anthranilate synthase component II 612 494

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: 3-dehydroquinate synthase
  • MTBC0 PGAP product: 3-dehydroquinate synthase
  • Pfam (hmmscan --cut_ga): Fe-ADH_2 PF13685.13 (E=3e-07), DHQ_synthase PF01761.27 (E=5e-42), DHQS_C PF24621.3 (E=5e-46)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_217054.1)
  • Domains: Pfam-A via hmmscan --cut_ga — Fe-ADH_2 (PF13685.13), DHQ_synthase (PF01761.27), DHQS_C (PF24621.3)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG0337
  • Curated reference: UniProt P9WPX9 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 46 functional partner(s); context anchor aroK
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_002704|Rv2538c|aroB
MTDIGAPVTVQVAVDPPYPVVIGTGLLDELEDLLADRHKVAVVHQPGLAETAEEIRKRLAGKGVDAHRIEIPDAEAGKDLPVVGFIWEVLGRIGIGRKDALVSLGGGAATDVAGFAAATWLRGVSIVHLPTTLLGMVDAAVGGKTGINTDAGKNLVGAFHQPLAVLVDLATLQTLPRDEMICGMAEVVKAGFIADPVILDLIEADPQAALDPAGDVLPELIRRAITVKAEVVAADEKESELREILNYGHTLGHAIERRERYRWRHGAAVSVGLVFAAELARLAGRLDDATAQRHRTILSSLGLPVSYDPDALPQLLEIMAGDKKTRAGVLRFVVLDGLAKPGRMVGPDPGLLVTAYAGVCAP