vapB30 Resolved · high auto-curated

H37Rv Rv0623 · MTBC0 mtbc0_000656 · 84 aa · 719963–720217 (+) · RefSeq NP_215137.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)antitoxin VapB30
MTBC0 PGAP re-annotationtype II toxin-antitoxin system antitoxin VapB30
Revised (this work)Type II toxin-antitoxin system antitoxin VapB30. Pfam: PSK_trans_fac (PF07704.18).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt P9WJ35 SwissProt · reviewed · Evidence at protein level
UniProt nameAntitoxin VapB30
Curated functionAntitoxin component of a type II toxin-antitoxin (TA) system. Upon expression in M.smegmatis neutralizes the effect of cognate toxin VapC30.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category K Transcription
eggNOG descriptionAntitoxin component of a type II toxin-antitoxin (TA) system. Upon
Orthologous groupCOG4423
KEGG orthology K19687
Gene Ontology (6) GO:0008150, GO:0040008, GO:0045927, GO:0048518, GO:0050789, GO:0065007

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
PSK_trans_facPF07704.18 1.5e-291–83 Rv0623-like transcription factor

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: vapC30 (ribonuclease VapC30), high confidence from genomic context alone (score 1000 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv0624 vapC30 ribonuclease VapC30 999 1000 ctx neighborhood:882 cooccurence:773 experimental:999 textmining:821
Rv0609 vapC28 ribonuclease VapC28 950 945 ctx cooccurence:772 experimental:754
Rv2759c vapC42 ribonuclease VapC42 959 944 ctx cooccurence:772 experimental:754
Rv1982c vapC36 ribonuclease VapC36 948 944 ctx cooccurence:773 experimental:754
Rv1741 vapC34 ribonuclease VapC34 876 864 experimental:853
Rv0622 membrane protein 584 584 ctx neighborhood:583
Rv2010 vapC15 ribonuclease VapC15 752 480 ctx cooccurence:454 textmining:544
Rv2021c higA2 transcriptional regulator 651 469 ctx cooccurence:445
Rv1560 vapB11 antitoxin VapB11 445 445 ctx cooccurence:419
Rv0621 membrane protein 413 413 ctx neighborhood:410
Rv0240 vapC24 ribonuclease VapC24 403 404 ctx cooccurence:403
Rv2549c vapC20 ribonuclease VapC20 408 202
Rv2018 vapB45 hyp hypothetical protein 596 196 textmining:519
Rv0608 vapB28 antitoxin VapB28 687 191 textmining:630
Rv0626 vapB5 antitoxin VapB5 812 86 textmining:803

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: antitoxin VapB30
  • MTBC0 PGAP product: type II toxin-antitoxin system antitoxin VapB30
  • Pfam (hmmscan --cut_ga): PSK_trans_fac PF07704.18 (E=2e-29)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_215137.1)
  • Domains: Pfam-A via hmmscan --cut_ga — PSK_trans_fac (PF07704.18)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG4423
  • Curated reference: UniProt P9WJ35 (SwissProt, reviewed; Evidence at protein level)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 26 functional partner(s); context anchor vapC30
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_000656|Rv0623|vapB30
MALSIKHPEADRLARALAARTGETLTEAVVTALRERLARETGRARVVPLRDELAAIRHRCAALPVVDNRSAEAILGYDERGLPA