Rv2551c Family assigned · medium auto-curated
H37Rv Rv2551c · MTBC0 mtbc0_002719 ·
139 aa · 2894320–2894739 (-) ·
RefSeq NP_217067.1
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | hypothetical protein |
|---|---|
| MTBC0 PGAP re-annotation | A24 family peptidase |
| Revised (this work) | A24 family peptidase. Pfam: Peptidase_A24 (PF01478.24). |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
Curated reference (UniProt)
| UniProt |
I6Y9M6
TrEMBL · unreviewed
· Inferred from homology
|
|---|---|
| UniProt name | Prepilin type IV endopeptidase peptidase domain-containing protein |
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
N Cell motilityO Post-translational modification, protein turnover, chaperonesU Intracellular trafficking, secretion and vesicular transport
|
|---|---|
| eggNOG description | peptidase |
| Orthologous group | COG1989 |
| EC number |
EC 3.4.23.43
|
| KEGG orthology |
K02654
|
| KEGG modules |
M00331
|
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS | 0.207 · purifying |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 4 synonymous, 2 missense, 0 nonsense, 0 frameshift |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
Peptidase_A24 | PF01478.24 | 7.3e-16 | 5–108 | Type IV leader peptidase family |
Functional interaction network (STRING v12, guilt-by-association)
Closest characterised functional partner: aroE (shikimate 5-dehydrogenase), high confidence from genomic context alone (score 940 excluding text-mining). This association is the citable seed of a function hypothesis for this hypothetical protein.
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv2552c aroE |
shikimate 5-dehydrogenase | 941 | 940 ctx | neighborhood:805 coexpression:703 |
Rv2553c mltG |
membrane protein | 849 | 849 ctx | neighborhood:800 |
Rv2554c ruvX |
Holliday junction resolvase | 802 | 802 ctx | neighborhood:793 |
Rv2555c alaS |
alanine--tRNA ligase | 797 | 797 ctx | neighborhood:791 |
Rv2556c hyp |
hypothetical protein | 746 | 746 ctx | neighborhood:735 |
Rv2896c dprA hyp |
hypothetical protein | 758 | 684 | coexpression:659 |
Rv1166 lpqW |
monoacyl phosphatidylinositol tetramannoside-binding protein LpqW | 672 | 673 ctx | cooccurence:660 |
Rv2415c hyp |
hypothetical protein | 729 | 646 | coexpression:645 |
Rv2539c aroK |
shikimate kinase | 640 | 604 ctx | neighborhood:543 |
Rv1631 coaE |
dephospho-CoA kinase CoaE | 613 | 598 | coexpression:459 |
Rv3438 hyp |
hypothetical protein | 585 | 586 ctx | cooccurence:585 |
Rv0882 |
transmembrane protein | 575 | 575 ctx | cooccurence:571 |
Rv0419 lpqM |
lipoprotein peptidase LpqM | 570 | 571 ctx | cooccurence:544 |
Rv2525c hyp |
hypothetical protein | 595 | 570 ctx | cooccurence:542 |
Rv0556 |
transmembrane protein | 560 | 561 ctx | cooccurence:558 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Legacy H37Rv annotation: hypothetical protein
- MTBC0 PGAP product: A24 family peptidase
- Pfam (hmmscan --cut_ga): Peptidase_A24 PF01478.24 (E=7e-16)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_217067.1)
- Domains: Pfam-A via hmmscan --cut_ga — Peptidase_A24 (PF01478.24)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
COG1989 - Curated reference: UniProt I6Y9M6 (TrEMBL, unreviewed; Inferred from homology)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
51 functional partner(s); context anchor
aroE - Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>mtbc0_002719|Rv2551c| MLAAAVLAWMGVLCVCDVRQRRLPNWLTLPGAGVILLFAGLAGRGVPALAGAAALAGVYLLVHLALPAAMGAGDVKLAIGLGGLTGCFGVEVWFLAALAAPLLTAVCGVMVTPWGVRTLPHGPSMCVASLGAVGLALLG