Rv2551c Family assigned · medium auto-curated

H37Rv Rv2551c · MTBC0 mtbc0_002719 · 139 aa · 2894320–2894739 (-) · RefSeq NP_217067.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)hypothetical protein
MTBC0 PGAP re-annotationA24 family peptidase
Revised (this work)A24 family peptidase. Pfam: Peptidase_A24 (PF01478.24).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt I6Y9M6 TrEMBL · unreviewed · Inferred from homology
UniProt namePrepilin type IV endopeptidase peptidase domain-containing protein

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category N Cell motility
O Post-translational modification, protein turnover, chaperones
U Intracellular trafficking, secretion and vesicular transport
eggNOG descriptionpeptidase
Orthologous groupCOG1989
EC number EC 3.4.23.43
KEGG orthology K02654
KEGG modules M00331

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.207 · purifying
Polymorphic sites (≥ 0.1% of strains) 4 synonymous, 2 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
Peptidase_A24PF01478.24 7.3e-165–108 Type IV leader peptidase family

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: aroE (shikimate 5-dehydrogenase), high confidence from genomic context alone (score 940 excluding text-mining). This association is the citable seed of a function hypothesis for this hypothetical protein.

PartnerProductScoreNo text-miningChannels (≥400)
Rv2552c aroE shikimate 5-dehydrogenase 941 940 ctx neighborhood:805 coexpression:703
Rv2553c mltG membrane protein 849 849 ctx neighborhood:800
Rv2554c ruvX Holliday junction resolvase 802 802 ctx neighborhood:793
Rv2555c alaS alanine--tRNA ligase 797 797 ctx neighborhood:791
Rv2556c hyp hypothetical protein 746 746 ctx neighborhood:735
Rv2896c dprA hyp hypothetical protein 758 684 coexpression:659
Rv1166 lpqW monoacyl phosphatidylinositol tetramannoside-binding protein LpqW 672 673 ctx cooccurence:660
Rv2415c hyp hypothetical protein 729 646 coexpression:645
Rv2539c aroK shikimate kinase 640 604 ctx neighborhood:543
Rv1631 coaE dephospho-CoA kinase CoaE 613 598 coexpression:459
Rv3438 hyp hypothetical protein 585 586 ctx cooccurence:585
Rv0882 transmembrane protein 575 575 ctx cooccurence:571
Rv0419 lpqM lipoprotein peptidase LpqM 570 571 ctx cooccurence:544
Rv2525c hyp hypothetical protein 595 570 ctx cooccurence:542
Rv0556 transmembrane protein 560 561 ctx cooccurence:558

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: hypothetical protein
  • MTBC0 PGAP product: A24 family peptidase
  • Pfam (hmmscan --cut_ga): Peptidase_A24 PF01478.24 (E=7e-16)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_217067.1)
  • Domains: Pfam-A via hmmscan --cut_ga — Peptidase_A24 (PF01478.24)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG1989
  • Curated reference: UniProt I6Y9M6 (TrEMBL, unreviewed; Inferred from homology)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 51 functional partner(s); context anchor aroE
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_002719|Rv2551c|
MLAAAVLAWMGVLCVCDVRQRRLPNWLTLPGAGVILLFAGLAGRGVPALAGAAALAGVYLLVHLALPAAMGAGDVKLAIGLGGLTGCFGVEVWFLAALAAPLLTAVCGVMVTPWGVRTLPHGPSMCVASLGAVGLALLG