Rv2556c Resolved · high auto-curated

H37Rv Rv2556c · MTBC0 mtbc0_002724 · 129 aa · 2900121–2900510 (-) · RefSeq NP_217072.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)hypothetical protein
MTBC0 PGAP re-annotationsecondary thiamine-phosphate synthase enzyme YjbQ
Revised (this work)Secondary thiamine-phosphate synthase enzyme YjbQ. Pfam: YjbQ (PF01894.23).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt P9WFP9 SwissProt · reviewed · Evidence at protein level
UniProt nameUPF0047 protein Rv2556c

UniProt still lists this protein as UPF0047 protein Rv2556c; the revised annotation above is ahead of the current UniProt record.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category S Function unknown
eggNOG descriptionUncharacterised protein family UPF0047
Orthologous groupCOG0432
Gene Ontology (6) GO:0005575, GO:0005618, GO:0005623, GO:0030312, GO:0044464, GO:0071944

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.36 · purifying
Polymorphic sites (≥ 0.1% of strains) 2 synonymous, 2 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
YjbQPF01894.23 5.1e-2713–124 UPF0047 protein YjbQ-like

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: alaS (alanine--tRNA ligase), high confidence from genomic context alone (score 789 excluding text-mining). This association is the citable seed of a function hypothesis for this hypothetical protein.

PartnerProductScoreNo text-miningChannels (≥400)
Rv2555c alaS alanine--tRNA ligase 789 789 ctx neighborhood:779
Rv2554c ruvX Holliday junction resolvase 788 789 ctx neighborhood:779
Rv2553c mltG membrane protein 782 782 ctx neighborhood:779
Rv2552c aroE shikimate 5-dehydrogenase 782 782 ctx neighborhood:779
Rv2551c hyp hypothetical protein 746 746 ctx neighborhood:735
Rv2557 hyp hypothetical protein 596 596 ctx neighborhood:594
Rv2558 hyp hypothetical protein 469 469 ctx neighborhood:466
Rv2540c aroF chorismate synthase 402 403

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: hypothetical protein
  • MTBC0 PGAP product: secondary thiamine-phosphate synthase enzyme YjbQ
  • Pfam (hmmscan --cut_ga): YjbQ PF01894.23 (E=5e-27)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_217072.1)
  • Domains: Pfam-A via hmmscan --cut_ga — YjbQ (PF01894.23)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG0432
  • Curated reference: UniProt P9WFP9 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 8 functional partner(s); context anchor alaS
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_002724|Rv2556c|
MLDVDTARRRIVDLTDAVRAFCTAHDDGLCNVFVPHATAGVAIIETGAGSDEDLVDTLVRLLPRDDRYRHAHGSYGHGADHLLPAFVAPSVTVPVSGGQPLLGTWQSIVLVDLNQDNPRRSVRLSFVEG