vapC20 Resolved · high auto-curated

H37Rv Rv2549c · MTBC0 mtbc0_002717 · 131 aa · 2893272–2893667 (-) · RefSeq NP_217065.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)ribonuclease VapC20
MTBC0 PGAP re-annotationtype II toxin-antitoxin system toxin 23S rRNA-specific endonuclease VapC20
Revised (this work)Type II toxin-antitoxin system toxin 23S rRNA-specific endonuclease VapC20. Pfam: PIN (PF01850.28).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt P95004 SwissProt · reviewed · Evidence at protein level
UniProt name23S rRNA-specific endonuclease VapC20
EC (curated) EC 3.1.-.-
Curated functionToxic component of a type II toxin-antitoxin (TA) system. An endoribonuclease that cleaves both E.coli and M.smegmatis 23S rRNA between G2661 and A2662 in the sarcin-ricin loop (SRL, E.coli 23S rRNA numbering). The SRL sequence is highly conserved and is implicated in GTP hydrolysis by EF-Tu and EF-G. Acts on purified ribosomes but not on isolated RNA in E.coli, nor on a shortened artificial substrate. Upon expression in E.coli inhibits cell growth, colony formation and translation. Its toxic effect is neutralized by coexpression, or subsequent expression (tested over 2 hours) with cognate ant.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category S Function unknown
eggNOG descriptiontoxic component of a
Orthologous groupCOG2402
KEGG orthology K07065
Gene Ontology (48) GO:0003674, GO:0003824, GO:0004518, GO:0004519, GO:0004521, GO:0004540, GO:0006139, GO:0006401, GO:0006725, GO:0006807, GO:0008150, GO:0008152 +36 more

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.231 · purifying
Polymorphic sites (≥ 0.1% of strains) 4 synonymous, 3 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
PINPF01850.28 2.4e-182–125 PIN domain

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: vapB20 (antitoxin VapB20), high confidence from genomic context alone (score 888 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv2550c vapB20 antitoxin VapB20 917 888 ctx neighborhood:882
Rv0581 vapB26 antitoxin VapB26 682 668 experimental:652
Rv2548A hyp hypothetical protein 592 592 ctx neighborhood:592
Rv0582 vapC26 ribonuclease VapC26 910 565 ctx cooccurence:562 textmining:803
Rv0240 vapC24 ribonuclease VapC24 531 532 ctx cooccurence:529
Rv0611c hyp hypothetical protein 517 518 ctx cooccurence:515
Rv1397c vapC10 ribonuclease VapC10 680 484 ctx cooccurence:475 textmining:406
Rv1034c Probable transposase (fragment); Rv1034c, (MTCY10G2.15), len: 129 aa. Probable IS1560 transposase fragment, similar to part of Rv3387|E12023 479 479 ctx cooccurence:479
Rv3386 transposase 465 465 ctx cooccurence:465
Rv2961 transposase 460 460 ctx cooccurence:460
Rv3387 transposase 439 439 ctx cooccurence:439
Rv2548 vapC19 ribonuclease VapC19 718 420 ctx cooccurence:408 textmining:534
Rv0659c mazF2 toxin MazF2 452 408 ctx cooccurence:406
Rv2949c chorismate pyruvate-lyase 408 408 ctx cooccurence:406
Rv2010 vapC15 ribonuclease VapC15 784 395 textmining:658

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: ribonuclease VapC20
  • MTBC0 PGAP product: type II toxin-antitoxin system toxin 23S rRNA-specific endonuclease VapC20
  • Pfam (hmmscan --cut_ga): PIN PF01850.28 (E=2e-18)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_217065.1)
  • Domains: Pfam-A via hmmscan --cut_ga — PIN (PF01850.28)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG2402
  • Curated reference: UniProt P95004 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 50 functional partner(s); context anchor vapB20
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_002717|Rv2549c|vapC20
MIFVDTSFWAALGNAGDARHGTAKRLWASKPPVVMTSNHVLGETWTLLNRRCGHRAAVAAAAIRLSTVVRVEHVTADLEEQAWEWLVRHDEREYSFVDATSFAVMRKKGIQNAYAFDGDFSAAGFVEVRPE