vapB20 Resolved · high auto-curated

H37Rv Rv2550c · MTBC0 mtbc0_002718 · 81 aa · 2893664–2893909 (-) · RefSeq NP_217066.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)antitoxin VapB20
MTBC0 PGAP re-annotationtype II toxin-antitoxin system antitoxin VapB20
Revised (this work)Type II toxin-antitoxin system antitoxin VapB20. Pfam: RHH_1 (PF01402.28).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt P9WJ45 SwissProt · reviewed · Evidence at protein level
UniProt nameAntitoxin VapB20
Curated functionAntitoxin component of a type II toxin-antitoxin (TA) system. Upon expression in E.coli neutralizes the toxic effect of cognate toxin VapC20.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS n/a
Polymorphic sites (≥ 0.1% of strains) 0 synonymous, 1 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
RHH_1PF01402.28 5.0e-0910–49 Ribbon-helix-helix protein, copG family

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: vapC20 (ribonuclease VapC20), high confidence from genomic context alone (score 888 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv2549c vapC20 ribonuclease VapC20 917 888 ctx neighborhood:882
Rv2548A hyp hypothetical protein 592 592 ctx neighborhood:592
Rv2493 vapB38 antitoxin VapB38 548 55 textmining:542
Rv2547 vapB19 antitoxin VapB19 634 53 textmining:630
Rv3378c diterpene synthase 514 50 textmining:510
Rv2009 vapB15 antitoxin VapB15 513 47 textmining:510
Rv3320c vapC44 ribonuclease VapC44 513 47 textmining:510
Rv2103c vapC37 ribonuclease VapC37 585 46 textmining:583
Rv3376 phosphatase 545 46 textmining:543
Rv2275 cyclo(L-tyrosyl-L-tyrosyl) synthase 658 44 textmining:657
Rv2955c hyp hypothetical protein 482 44 textmining:481
Rv3087 diacyglycerol O-acyltransferase 412 43 textmining:411
Rv1288 hyp hypothetical protein 655 41 textmining:655
Rv0064 transmembrane protein 650 41 textmining:650
Rv0240 vapC24 ribonuclease VapC24 627 41 textmining:627

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: antitoxin VapB20
  • MTBC0 PGAP product: type II toxin-antitoxin system antitoxin VapB20
  • Pfam (hmmscan --cut_ga): RHH_1 PF01402.28 (E=5e-09)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_217066.1)
  • Domains: Pfam-A via hmmscan --cut_ga — RHH_1 (PF01402.28)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Curated reference: UniProt P9WJ45 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 23 functional partner(s); context anchor vapC20
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_002718|Rv2550c|vapB20
MLVAYICHVKRLQIYIDEDVDRALAVEARRRRTSKAALIREYVAEHLRQPGPDPVDAFVGSFVGEADLSASVDDVVYGKHE