vapB27 Resolved · high auto-curated

H37Rv Rv0599c · MTBC0 mtbc0_000629 · 78 aa · 701116–701352 (-) · RefSeq NP_215113.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)antitoxin VapB27
MTBC0 PGAP re-annotationtype II toxin-antitoxin system antitoxin VapB27
Revised (this work)Type II toxin-antitoxin system antitoxin VapB27. Pfam: MazE_antitoxin (PF04014.24).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt O07779 SwissProt · reviewed · Evidence at protein level
UniProt nameAntitoxin VapB27
Curated functionAntitoxin component of a type II toxin-antitoxin (TA) system. Cognate toxin is VapC27. Upon expression in E.coli partially counteracts the ribonuclease activity of non-cognate toxins MazF6 and MazF9.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category K Transcription
eggNOG descriptionSpoVT / AbrB like domain
Orthologous groupCOG2002

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.37 · purifying
Polymorphic sites (≥ 0.1% of strains) 1 synonymous, 1 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
MazE_antitoxinPF04014.24 2.8e-095–45 Antidote-toxin recognition MazE, bacterial antitoxin

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: vapC27 (ribonuclease VapC27), high confidence from genomic context alone (score 909 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv0598c vapC27 ribonuclease VapC27 957 909 ctx neighborhood:882 textmining:546
Rv0600c two component sensor kinase HK1 546 526 ctx neighborhood:523
Rv3433c nnr bifunctional ADP-dependent (S)-NAD(P)H-hydrate dehydratase/NAD(P)H-hydrate epimerase 472 472 coexpression:456
Rv0597c hyp hypothetical protein 437 437 ctx neighborhood:424
Rv0601c two component sensor kinase HK2 413 387
Rv0617 vapC29 ribonuclease VapC29 665 80 textmining:651
Rv2801c mazF9 mRNA interferase MazF9 483 78 textmining:463
Rv0065 vapC1 ribonuclease VapC1 642 73 textmining:630
Rv2595 vapB40 antitoxin VapB40 658 55 textmining:653
Rv2801A mazE9 antitoxin MazE9 446 54 textmining:439
Rv2547 vapB19 antitoxin VapB19 517 51 textmining:512
Rv2530A vapB39 antitoxin VapB39 657 47 textmining:655
Rv0064A vapB1 antitoxin VapB1 801 41 textmining:801
Rv0616A vapB29 antitoxin VapB29 651 41 textmining:651
Rv0456B mazE1 antitoxin MazE1 625 41 textmining:625

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: antitoxin VapB27
  • MTBC0 PGAP product: type II toxin-antitoxin system antitoxin VapB27
  • Pfam (hmmscan --cut_ga): MazE_antitoxin PF04014.24 (E=3e-09)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_215113.1)
  • Domains: Pfam-A via hmmscan --cut_ga — MazE_antitoxin (PF04014.24)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG2002
  • Curated reference: UniProt O07779 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 16 functional partner(s); context anchor vapC27
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_000629|Rv0599c|vapB27
MKAVVDAAGRIVVPKPLREALGLQPGSTVEISRYGAGLHLIPTGRTARLEEENGVLVATGETTIDDEVVFGLIDSGRK