vapB28 Family assigned · medium auto-curated

H37Rv Rv0608 · MTBC0 mtbc0_000638 · 81 aa · 706796–707041 (+) · RefSeq NP_215122.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)antitoxin VapB28
MTBC0 PGAP re-annotationtype II toxin-antitoxin system VapB family antitoxin
Revised (this work)Type II toxin-antitoxin system VapB family antitoxin. Pfam: PSK_trans_fac (PF07704.18).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt P9WJ39 SwissProt · reviewed · Evidence at protein level
UniProt nameAntitoxin VapB28
Curated functionAntitoxin component of a type II toxin-antitoxin (TA) system. Upon expression in M.smegmatis neutralizes the effect of cognate toxin VapC28.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category S Function unknown
Preferred namevapB28
eggNOG descriptionRv0623-like transcription factor
Orthologous groupCOG4423
KEGG orthology K19687
Gene Ontology (6) GO:0008150, GO:0040008, GO:0045927, GO:0048518, GO:0050789, GO:0065007

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS n/a
Polymorphic sites (≥ 0.1% of strains) 0 synonymous, 1 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
PSK_trans_facPF07704.18 2.3e-241–80 Rv0623-like transcription factor

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: vapC28 (ribonuclease VapC28), high confidence from genomic context alone (score 930 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv0609 vapC28 ribonuclease VapC28 932 930 ctx neighborhood:882
Rv0609A hyp hypothetical protein 803 803 ctx neighborhood:801
Rv0607 hyp hypothetical protein 675 675 ctx neighborhood:675
Rv0605 IS1536 family serine type transposase 559 559 ctx neighborhood:552
Rv0606 Possible transposase (fragment); Rv0606, (MTCY19H5.16c), len: 247 aa. Possible truncated transposase for IS_1536 element, highly similar to 557 557 ctx neighborhood:552
Rv0624 vapC30 ribonuclease VapC30 465 443
Rv2759c vapC42 ribonuclease VapC42 455 433
Rv1741 vapC34 ribonuclease VapC34 455 433
Rv1982c vapC36 ribonuclease VapC36 452 430
Rv0623 vapB30 antitoxin VapB30 687 191 textmining:630
Rv0595c vapC4 ribonuclease VapC4 621 139 textmining:578
Rv1740 vapB34 antitoxin VapB34 619 55 textmining:614
Rv2021c higA2 transcriptional regulator 418 53 textmining:411
Rv3321c vapB44 antitoxin VapB44 626 47 textmining:624
Rv2547 vapB19 antitoxin VapB19 521 47 textmining:518

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: antitoxin VapB28
  • MTBC0 PGAP product: type II toxin-antitoxin system VapB family antitoxin
  • Pfam (hmmscan --cut_ga): PSK_trans_fac PF07704.18 (E=2e-24)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_215122.1)
  • Domains: Pfam-A via hmmscan --cut_ga — PSK_trans_fac (PF07704.18)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG4423
  • Curated reference: UniProt P9WJ39 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 22 functional partner(s); context anchor vapC28
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_000638|Rv0608|vapB28
MALNIKDPSVHQAVKQIAKITGESQARAVATAVNERLARLRSDDLAARLLAIGHKTASRMSPEAKRLDHDALLYDERGLPA