mltG Resolved · high auto-curated
H37Rv Rv2553c · MTBC0 mtbc0_002721 ·
417 aa · 2895557–2896810 (-) ·
RefSeq NP_217069.1
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | membrane protein |
|---|---|
| MTBC0 PGAP re-annotation | endolytic transglycosylase MltG |
| Revised (this work) | Endolytic transglycosylase MltG. Pfam: YceG (PF02618.22). |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
Curated reference (UniProt)
| UniProt |
I6XEK6
TrEMBL · unreviewed
· Evidence at protein level
|
|---|---|
| UniProt name | Endolytic murein transglycosylase |
| EC (curated) |
EC 4.2.2.29
|
| Curated function | Functions as a peptidoglycan terminase that cleaves nascent peptidoglycan strands endolytically to terminate their elongation. |
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
S Function unknown
|
|---|---|
| Preferred name | mltG |
| eggNOG description | Functions as a peptidoglycan terminase that cleaves nascent peptidoglycan strands endolytically to terminate their elongation |
| Orthologous group | COG1559 |
| KEGG orthology |
K07082
|
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS | 1.054 · relaxed/neutral |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 1 synonymous, 3 missense, 0 nonsense, 0 frameshift |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
YceG | PF02618.22 | 3.4e-65 | 86–405 | YceG-like family |
Functional interaction network (STRING v12, guilt-by-association)
Closest characterised functional partner: aroE (shikimate 5-dehydrogenase), high confidence from genomic context alone (score 968 excluding text-mining).
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv2552c aroE |
shikimate 5-dehydrogenase | 968 | 968 ctx | neighborhood:881 coexpression:746 |
Rv2555c alaS |
alanine--tRNA ligase | 939 | 940 ctx | neighborhood:881 coexpression:514 |
Rv2554c ruvX |
Holliday junction resolvase | 908 | 909 ctx | neighborhood:882 |
Rv2551c hyp |
hypothetical protein | 849 | 849 ctx | neighborhood:800 |
Rv2556c hyp |
hypothetical protein | 782 | 782 ctx | neighborhood:779 |
Rv1797 eccE5 |
ESX-5 type VII secretion system protein EccE | 778 | 778 | coexpression:778 |
Rv3870 eccCa1 |
ESX-1 secretion system protein EccCa | 776 | 777 | coexpression:731 |
Rv2364c era |
GTPase Era | 743 | 744 | coexpression:735 |
Rv0819 mshD |
mycothiol acetyltransferase | 735 | 736 | coexpression:735 |
Rv2942 mmpL7 |
transmembrane transport protein MmpL7 | 747 | 735 | coexpression:734 |
Rv3092c |
integral membrane protein | 733 | 733 | coexpression:733 |
Rv2851c |
GCN5-like N-acetyltransferase | 731 | 732 | coexpression:731 |
Rv3806c ubiA |
decaprenyl-phosphate phosphoribosyltransferase | 731 | 731 | coexpression:731 |
Rv3608c folP1 |
dihydropteroate synthase | 790 | 662 | coexpression:651 textmining:405 |
Rv3682 ponA2 |
bifunctional penicillin-insensitive transglycosylase/penicillin-sensitive transpeptidase | 782 | 643 ctx | cooccurence:577 textmining:416 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Legacy H37Rv annotation: membrane protein
- MTBC0 PGAP product: endolytic transglycosylase MltG
- Pfam (hmmscan --cut_ga): YceG PF02618.22 (E=3e-65)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_217069.1)
- Domains: Pfam-A via hmmscan --cut_ga — YceG (PF02618.22)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
COG1559 - Curated reference: UniProt I6XEK6 (TrEMBL, unreviewed; Evidence at protein level)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
49 functional partner(s); context anchor
aroE - Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>mtbc0_002721|Rv2553c|mltG MPDGGHRHRAQPVSVRPNRHRRTRVSRAQRRHAQQIRRRRRVAGGFALSLLVVVVVVAVVVGAKLWQTMLGFGNDYTGPGKRDIVIQIRAGDSTTAVGETLLKHGVVATVRAFVDAAHGNTAISSIQPGFYRMRTEISAASAVARLTDPHNRVGKLVIPEGRQLDDTTDMKTNVVNPGIFALISRATCVDLDGTQRCVSVADLRAAASRSTPTMLSVPRWAVGPVMELGTDHRRIEGLIAPGTFNIDPSASAETILATLISAGAVEYMKSGLVDTAKSLGLSPYDILVVASLVQQEANTQDFPKVARVIYNRLHEHRTLEFDSTVNYPLDRREVATSDTDRAQRTPWNTYMAQGLPATAICSPGVDALRAAEHPVPGDWLYFVTIDSQGTTLFTRDYQQHLANIELAKHNGVLDSAR