vapB39 Resolved · medium auto-curated

H37Rv Rv2530A · MTBC0 - · 74 aa · 2854683–2854907 (-) · RefSeq YP_177672.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)antitoxin VapB39
MTBC0 PGAP re-annotation
Revised (this work)Antitoxin VapB39.

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Annotated on the H37Rv protein: this gene has no 1:1 ancestral MTBC0 anchor (PE/PPE, paralogue, IS element, or otherwise unanchored CDS).

Curated reference (UniProt)

UniProt P9WJ23 SwissProt · reviewed · Evidence at protein level
UniProt nameAntitoxin VapB39
Curated functionAntitoxin component of a type II toxin-antitoxin (TA) system. Upon expression in M.smegmatis neutralizes the effect of cognate toxin VapC39.

Functional vocabulary (eggNOG-mapper, orthology transfer)

Preferred namevapB39
Orthologous group2DU51
Gene Ontology (6) GO:0008150, GO:0040008, GO:0045927, GO:0048518, GO:0050789, GO:0065007

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS n/a
Polymorphic sites (≥ 0.1% of strains) 0 synonymous, 2 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

No Pfam-A domain above the gathering threshold (or not yet scanned).

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: Rv2531c (amino acid decarboxylase), high confidence from genomic context alone (score 830 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv2531c amino acid decarboxylase 829 830 ctx neighborhood:828
Rv2530c vapC39 ribonuclease VapC39 848 829 ctx neighborhood:801
Rv2532c hyp hypothetical protein 526 526 ctx neighborhood:523
Rv2533c nusB N utilization substance protein B 526 526 ctx neighborhood:523
Rv2534c efp elongation factor P 525 524 ctx neighborhood:523
Rv2535c pepQ cytoplasmic peptidase PepQ 517 518 ctx neighborhood:515
Rv2536 transmembrane protein 407 407 ctx neighborhood:404
Rv0599c vapB27 antitoxin VapB27 657 47 textmining:655
Rv2547 vapB19 antitoxin VapB19 552 47 textmining:550
Rv2816c cas2 CRISPR-associated endoribonuclease Cas2 444 46 textmining:442

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Annotation from H37Rv (no MTBC0 1:1 anchor; H37Rv protein used): antitoxin VapB39
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq YP_177672.1)
  • Domains: Pfam-A via hmmscan --cut_ga — none above threshold
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG 2DU51
  • Curated reference: UniProt P9WJ23 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 10 functional partner(s); context anchor Rv2531c
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>H37Rv|Rv2530A|vapB39
MRTTLQIDDDVLEDARSIARSEGKSVGAVISELARRSLRPVGIVEVDGFPVFDVPPDAPTVTSEDVVRALEDDV