aroK Resolved · high auto-curated

H37Rv Rv2539c · MTBC0 mtbc0_002705 · 176 aa · 2885563–2886093 (-) · RefSeq NP_217055.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)shikimate kinase
MTBC0 PGAP re-annotationshikimate kinase AroK
Revised (this work)Shikimate kinase AroK. Pfam: AAA_33 (PF13671.13), AAA_18 (PF13238.13), SKI (PF01202.29).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt P9WPY3 SwissProt · reviewed · Evidence at protein level
UniProt nameShikimate kinase
EC (curated) EC 2.7.1.71
Curated functionCatalyzes the specific phosphorylation of the 3-hydroxyl group of shikimic acid using ATP as a cosubstrate.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category F Nucleotide transport and metabolism
Preferred namearoK
eggNOG descriptionCatalyzes the specific phosphorylation of the 3-hydroxyl group of shikimic acid using ATP as a cosubstrate
Orthologous groupCOG0703
EC number EC 2.7.1.71
KEGG orthology K00891
KEGG pathways map00400, map01100, map01110, map01130, map01230
KEGG modules M00022
Gene Ontology (73) GO:0000166, GO:0000287, GO:0003674, GO:0003824, GO:0004765, GO:0005488, GO:0005524, GO:0005575, GO:0005622, GO:0005623, GO:0005737, GO:0005829 +61 more

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS n/a
Polymorphic sites (≥ 0.1% of strains) 0 synonymous, 1 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
AAA_33PF13671.13 8.3e-086–71 AAA domain
AAA_18PF13238.13 1.3e-077–74 AAA domain
SKIPF01202.29 2.1e-4711–166 Shikimate kinase

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: aroB (3-dehydroquinate synthase), high confidence from genomic context alone (score 1000 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv2538c aroB 3-dehydroquinate synthase 999 1000 ctx neighborhood:882 fusion:900 cooccurence:753 coexpression:942 textmining:929
Rv2540c aroF chorismate synthase 997 980 ctx neighborhood:882 cooccurence:756 textmining:863
Rv2552c aroE shikimate 5-dehydrogenase 992 978 ctx neighborhood:544 cooccurence:529 database:900 textmining:668
Rv3227 aroA 3-phosphoshikimate 1-carboxyvinyltransferase 988 977 ctx cooccurence:562 coexpression:471 database:900 textmining:529
Rv2537c aroD 3-dehydroquinate dehydratase 952 919 ctx neighborhood:882 textmining:433
Rv2553c mltG membrane protein 610 611 ctx neighborhood:544
Rv2551c hyp hypothetical protein 640 604 ctx neighborhood:543
Rv2541 hyp hypothetical protein 573 573 ctx neighborhood:569
Rv2554c ruvX Holliday junction resolvase 564 565 ctx neighborhood:544
Rv2555c alaS alanine--tRNA ligase 560 561 ctx neighborhood:544
Rv3859c gltB glutamate synthase large subunit 545 546 ctx neighborhood:544
Rv1390 rpoZ DNA-directed RNA polymerase subunit omega 571 524 coexpression:455
Rv3754 tyrA prephenate dehydrogenase TyrA 790 497 textmining:601
Rv2572c aspS aspartate--tRNA ligase 537 468
Rv1005c pabB para-aminobenzoate synthase component I 503 449 ctx cooccurence:421

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: shikimate kinase
  • MTBC0 PGAP product: shikimate kinase AroK
  • Pfam (hmmscan --cut_ga): AAA_33 PF13671.13 (E=8e-08), AAA_18 PF13238.13 (E=1e-07), SKI PF01202.29 (E=2e-47)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_217055.1)
  • Domains: Pfam-A via hmmscan --cut_ga — AAA_33 (PF13671.13), AAA_18 (PF13238.13), SKI (PF01202.29)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG0703
  • Curated reference: UniProt P9WPY3 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 52 functional partner(s); context anchor aroB
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_002705|Rv2539c|aroK
MAPKAVLVGLPGSGKSTIGRRLAKALGVGLLDTDVAIEQRTGRSIADIFATDGEQEFRRIEEDVVRAALADHDGVLSLGGGAVTSPGVRAALAGHTVVYLEISAAEGVRRTGGNTVRPLLAGPDRAEKYRALMAKRAPLYRRVATMRVDTNRRNPGAVVRHILSRLQVPSPSEAAT