vapB41 Resolved · medium auto-curated

H37Rv Rv2601A · MTBC0 - · 95 aa · 2930070–2930357 (+) · RefSeq YP_177673.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)antitoxin VapB41
MTBC0 PGAP re-annotation
Revised (this work)Antitoxin VapB41.

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Annotated on the H37Rv protein: this gene has no 1:1 ancestral MTBC0 anchor (PE/PPE, paralogue, IS element, or otherwise unanchored CDS).

Curated reference (UniProt)

UniProt P9WJ21 SwissProt · reviewed · Evidence at protein level
UniProt nameAntitoxin VapB41
Curated functionAntitoxin component of a type II toxin-antitoxin (TA) system. Upon expression in M.smegmatis neutralizes the effect of cognate toxin VapC41.

Functional vocabulary (eggNOG-mapper, orthology transfer)

Orthologous group2DGZX
Gene Ontology (6) GO:0008150, GO:0040008, GO:0045927, GO:0048518, GO:0050789, GO:0065007

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 1.325 · diversifying/relaxed
Polymorphic sites (≥ 0.1% of strains) 1 synonymous, 4 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

No Pfam-A domain above the gathering threshold (or not yet scanned).

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: vapC41 (ribonuclease VapC41), high confidence from genomic context alone (score 930 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv2602 vapC41 ribonuclease VapC41 930 930 ctx neighborhood:882 coexpression:431
Rv2600 integral membrane protein 551 551 ctx neighborhood:551
Rv2601 speE spermidine synthase 530 529 ctx neighborhood:528
Rv2527 vapC17 ribonuclease VapC17 472 415
Rv0229c vapC51 hyp hypothetical protein 434 412
Rv2010 vapC15 ribonuclease VapC15 434 412
Rv0301 vapC2 ribonuclease VapC2 434 412
Rv0595c vapC4 ribonuclease VapC4 450 410
Rv1397c vapC10 ribonuclease VapC10 432 410
Rv0627 vapC5 ribonuclease VapC5 432 410
Rv2757c vapC21 ribonuclease VapC21 432 410
Rv0656c vapC6 ribonuclease VapC6 431 409
Rv2548 vapC19 ribonuclease VapC19 431 408
Rv1561 vapC11 ribonuclease VapC11 430 408
Rv1953 vapC14 ribonuclease VapC14 429 407

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Annotation from H37Rv (no MTBC0 1:1 anchor; H37Rv protein used): antitoxin VapB41
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq YP_177673.1)
  • Domains: Pfam-A via hmmscan --cut_ga — none above threshold
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG 2DGZX
  • Curated reference: UniProt P9WJ21 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 37 functional partner(s); context anchor vapC41
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>H37Rv|Rv2601A|vapB41
MKTTLDLPDELMRAIKVRAAQQGRKMKDVVTELLRSGLSQTHSGAPIPTPRRVQLPLVHCGGAATREQEMTPERVAAALLDQEAQWWSGHDDAAL