Rv2507 Family assigned · medium auto-curated
H37Rv Rv2507 · MTBC0 mtbc0_002669 ·
273 aa · 2845328–2846149 (+) ·
RefSeq NP_217023.1
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | hypothetical protein |
|---|---|
| MTBC0 PGAP re-annotation | MmpS family transport accessory protein |
| Revised (this work) | MmpS family transport accessory protein. Pfam: Mycobact_memb (PF05423.19). |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
Curated reference (UniProt)
| UniProt |
O06170
TrEMBL · unreviewed
· Evidence at protein level
|
|---|---|
| UniProt name | Possible conserved proline rich membrane protein |
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
S Function unknown
|
|---|---|
| eggNOG description | membrane |
| Orthologous group | 2ANP2 |
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS | 0.089 · strong purifying |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 4 synonymous, 1 missense, 0 nonsense, 0 frameshift |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
Mycobact_memb | PF05423.19 | 4.0e-05 | 187–262 | Mycobacterium membrane protein |
Functional interaction network (STRING v12, guilt-by-association)
Closest characterised functional partner: pirG (cell surface protein), high confidence from genomic context alone (score 747 excluding text-mining). This association is the citable seed of a function hypothesis for this hypothetical protein.
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv3810 pirG |
cell surface protein | 746 | 747 ctx | cooccurence:744 |
Rv3446c hyp |
hypothetical protein | 718 | 718 ctx | cooccurence:717 |
Rv1125 hyp |
hypothetical protein | 681 | 682 ctx | cooccurence:680 |
Rv0538 |
membrane protein | 671 | 672 ctx | cooccurence:667 |
Rv1836c hyp |
hypothetical protein | 651 | 651 ctx | cooccurence:648 |
Rv1158c hyp |
hypothetical protein | 648 | 648 ctx | cooccurence:644 |
Rv2721c hyp |
hypothetical protein | 646 | 646 ctx | cooccurence:643 |
Rv0878c PPE13 |
PPE family protein PPE13 | 637 | 637 ctx | cooccurence:635 |
Rv2506 |
TetR family transcriptional regulator | 637 | 637 ctx | neighborhood:635 |
Rv0497 |
transmembrane protein | 636 | 636 ctx | cooccurence:632 |
Rv2608 PPE42 |
PPE family protein PPE42 | 612 | 613 ctx | cooccurence:609 |
Rv0442c PPE10 |
PPE family protein PPE10 | 591 | 592 ctx | cooccurence:586 |
Rv3533c PPE62 |
PPE family protein PPE62 | 588 | 589 ctx | cooccurence:586 |
Rv0755c PPE12 |
PPE family protein PPE12 | 577 | 578 ctx | cooccurence:570 |
Rv3906c hyp |
hypothetical protein | 572 | 572 ctx | cooccurence:571 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Legacy H37Rv annotation: hypothetical protein
- MTBC0 PGAP product: MmpS family transport accessory protein
- Pfam (hmmscan --cut_ga): Mycobact_memb PF05423.19 (E=4e-05)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_217023.1)
- Domains: Pfam-A via hmmscan --cut_ga — Mycobact_memb (PF05423.19)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
2ANP2 - Curated reference: UniProt O06170 (TrEMBL, unreviewed; Evidence at protein level)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
66 functional partner(s); context anchor
pirG - Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>mtbc0_002669|Rv2507| MNDPRRPQRFGPPLSGYGPTGPQVPPNPPTADPAYADQSPYASTYGGYVSPPWSPGGPPPRPPQWPPGPHEASPTQQLPQYWQYDQPPPGGFPPDGLTPPPPQGPRTPRWLWFAAGSAVLLVVALVIALVIANGSVKKQTAIEPLPPMPGPSPTRPTTTTPTPPSPSAAPAPTTTTGTPSETVAGAMQTVVYDVTGEGRAISITYMDSGNVIQTEFNVALPWRKEVSLSKSSLHPASVTIVNIGHNVTCSVTVAGVQVRQRTGAGLTICDAPS