Rv2507 Family assigned · medium auto-curated

H37Rv Rv2507 · MTBC0 mtbc0_002669 · 273 aa · 2845328–2846149 (+) · RefSeq NP_217023.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)hypothetical protein
MTBC0 PGAP re-annotationMmpS family transport accessory protein
Revised (this work)MmpS family transport accessory protein. Pfam: Mycobact_memb (PF05423.19).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt O06170 TrEMBL · unreviewed · Evidence at protein level
UniProt namePossible conserved proline rich membrane protein

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category S Function unknown
eggNOG descriptionmembrane
Orthologous group2ANP2

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.089 · strong purifying
Polymorphic sites (≥ 0.1% of strains) 4 synonymous, 1 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
Mycobact_membPF05423.19 4.0e-05187–262 Mycobacterium membrane protein

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: pirG (cell surface protein), high confidence from genomic context alone (score 747 excluding text-mining). This association is the citable seed of a function hypothesis for this hypothetical protein.

PartnerProductScoreNo text-miningChannels (≥400)
Rv3810 pirG cell surface protein 746 747 ctx cooccurence:744
Rv3446c hyp hypothetical protein 718 718 ctx cooccurence:717
Rv1125 hyp hypothetical protein 681 682 ctx cooccurence:680
Rv0538 membrane protein 671 672 ctx cooccurence:667
Rv1836c hyp hypothetical protein 651 651 ctx cooccurence:648
Rv1158c hyp hypothetical protein 648 648 ctx cooccurence:644
Rv2721c hyp hypothetical protein 646 646 ctx cooccurence:643
Rv0878c PPE13 PPE family protein PPE13 637 637 ctx cooccurence:635
Rv2506 TetR family transcriptional regulator 637 637 ctx neighborhood:635
Rv0497 transmembrane protein 636 636 ctx cooccurence:632
Rv2608 PPE42 PPE family protein PPE42 612 613 ctx cooccurence:609
Rv0442c PPE10 PPE family protein PPE10 591 592 ctx cooccurence:586
Rv3533c PPE62 PPE family protein PPE62 588 589 ctx cooccurence:586
Rv0755c PPE12 PPE family protein PPE12 577 578 ctx cooccurence:570
Rv3906c hyp hypothetical protein 572 572 ctx cooccurence:571

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: hypothetical protein
  • MTBC0 PGAP product: MmpS family transport accessory protein
  • Pfam (hmmscan --cut_ga): Mycobact_memb PF05423.19 (E=4e-05)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_217023.1)
  • Domains: Pfam-A via hmmscan --cut_ga — Mycobact_memb (PF05423.19)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG 2ANP2
  • Curated reference: UniProt O06170 (TrEMBL, unreviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 66 functional partner(s); context anchor pirG
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_002669|Rv2507|
MNDPRRPQRFGPPLSGYGPTGPQVPPNPPTADPAYADQSPYASTYGGYVSPPWSPGGPPPRPPQWPPGPHEASPTQQLPQYWQYDQPPPGGFPPDGLTPPPPQGPRTPRWLWFAAGSAVLLVVALVIALVIANGSVKKQTAIEPLPPMPGPSPTRPTTTTPTPPSPSAAPAPTTTTGTPSETVAGAMQTVVYDVTGEGRAISITYMDSGNVIQTEFNVALPWRKEVSLSKSSLHPASVTIVNIGHNVTCSVTVAGVQVRQRTGAGLTICDAPS